@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0770: (2015-12-18 )
MILKNAIALTGGIGTGKSTTLKILESQGYKILDADKIAHQLLQEHRLEIAQRFGSDILEKDILNRKKLGAIVFQNANELKWLEDFLHPLIRECMLKKACELEKNHQAYFLDIPLFFEVGGKKRYPVSRVVLIYAPRALQIERLLERDKLKEAEILQRLACQMDIEQKRAMSDYIIDNSSSLKDLNKQVERFLKTLL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BU2_A_2(4TTR)
COAE_LEGPH
[Raw transfer]




BA3_A_6(1VHT)
COAE_ECOLI
[Raw transfer]




35 HHSearch 92.1231%-109 - C1 -1VHT 8.5 COAE_ECOLI
23 Fugue 89.4626%-109 - C1 -1JJV - COAE_HAEIN -
34 HHSearch 89.0928%-101 - C1 -2F6R - -
12 PsiBlast_PDB 86.9230%-106 - C1 -4I1U - ? -
37 HHSearch 86.7233%-102 - C1 -2IF2 - COAE_AQUAE -
15 PsiBlast_PDB 85.9130%-107 - C1 -2F6R - -
3 PsiBlast_PDB 85.8032%-120 - C1 -4TTQ - COAE_LEGPH -
5 PsiBlast_PDB 85.5234%-114 - C1 -2IF2 - COAE_AQUAE -
6 PsiBlast_PDB 85.1430% -99 - C1 -1VHL - COAE_ECOLI -
11 PsiBlast_PDB 84.8333%-103 - C1 -2GRJ - COAE_THEMA -
13 PsiBlast_PDB 84.8230%-102 - C1 -4I1V - ? -
4 PsiBlast_PDB 84.7632%-119 - C1 -4TTR 2.3 COAE_LEGPH
7 PsiBlast_PDB 84.7430% -99 - C1 -1VHT - COAE_ECOLI -
2 PsiBlast_PDB 84.4732%-110 - C1 -4TTP - COAE_LEGPH -
8 PsiBlast_PDB 84.0930% -98 - C1 -1VIY - COAE_ECOLI -
33 HHSearch 83.9532% -88 - C1 -1UF9 - COAE_THET8 -
36 HHSearch 83.3133%-100 - C1 -2GRJ - COAE_THEMA -
9 PsiBlast_PDB 81.9830%-102 - C1 -1T3H - COAE_ECOLI -
10 PsiBlast_PDB 80.6730% -96 - C1 -1N3B - COAE_ECOLI -
16 PsiBlast_PDB 77.4922% -90 - C1 -3LW7 - Y1041_SULSO -