@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0840: (2015-12-18 )
MEILVLNLGSSSIKFKLFDMKENKPLASGLAEKIGEEIGQLKIKSHLHHNDQELKEKLVIKDHAIGLLMIRENLTKMGIIKDFNQIDAIGHRVVQGGDKFHAPVLVDEKVMREIGNLSILAPLHNPANLAGIEFVQKAHPHIPQIAVFDTAFHASMPSYAYMYALPYELYEKYQIRRYGFHGTSHHYVAKEAAKFLNIPYEEFNAISLHLGNGSSAAAIQNGKSVDTSMGLTPLEGLIMGTRCGDIDPTVVEYIAQCANKSLEEVMKILNHESGLKGICGDNDARNIEVRKEKGDKQAKLAFEMCVYRIKKYIGAYMVVLKKVDAIIFTGGLGENYSALRESVCEGLENLGIALHKPTNDNPGSALVNLSQPNTKIQILRIPTDEELEIALQAKEMVEKIKVV

Atome Classification :

(33 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AQP_A_4(4FWN)
TDCD_SALTY
[Raw transfer]




ATP_A_6(4FWM)
TDCD_SALTY
[Raw transfer]




B4P_A_2(2E1Z)
TDCD_SALTY
[Raw transfer]




GTP_A_4(4FWQ)
TDCD_SALTY
[Raw transfer]




B4P_A_2(2E20)
TDCD_SALTY
[Raw transfer]




ADP_F_6(1G99)
ACKA_METTE
[Raw transfer]




CTP_A_6(4FWS)
TDCD_SALTY
[Raw transfer]




ANP_E_5(1X3N)
TDCD_SALTY
[Raw transfer]




ADP_E_5(1G99)
ACKA_METTE
[Raw transfer]




ADP_E_5(1G99)
ACKA_METTE
[Raw transfer]




GDP_A_4(4FWP)
TDCD_SALTY
[Raw transfer]




ADP_E_5(1TUU)
ACKA_METTE
[Raw transfer]




ADP_E_5(1G99)
ACKA_METTE
[Raw transfer]




ADP_C_3(1X3M)
TDCD_SALTY
[Raw transfer]




APC_A_3(4IZ9)
ACKA_MYCA1
[Raw transfer]




ADP_A_4(1TUY)
ACKA_METTE
[Raw transfer]




ADP_B_5(1TUY)
ACKA_METTE
[Raw transfer]




AMP_F_6(1TUU)
ACKA_METTE
[Raw transfer]




AMP_A_3(4FWK)
TDCD_SALTY
[Raw transfer]




5GP_A_5(4FWO)
TDCD_SALTY
[Raw transfer]




C5P_A_4(4FWR)
TDCD_SALTY
[Raw transfer]




PGE_B_6(3R9P)
ACKA_MYCPA
[Raw transfer]




EDO_A_6(4IJN)
ACKA_MYCS2
[Raw transfer]




PGE_A_5(3R9P)
ACKA_MYCPA
[Raw transfer]




EDO_B_9(4IJN)
ACKA_MYCS2
[Raw transfer]




PGE_A_5(3R9P)
ACKA_MYCPA
[Raw transfer]




EDO_A_2(4FWL)
TDCD_SALTY
[Raw transfer]




ACY_B_7(1TUY)
ACKA_METTE
[Raw transfer]




43 Fugue 96.3446% -94 - C5 -1G99 5.8 ACKA_METTE
1 PsiBlast_PDB 96.3049%-101 - C5 -2IIR - ACKA_THEMA -
53 HHSearch 94.8846% -93 - C5 -1G99 5.8 ACKA_METTE
3 PsiBlast_PDB 94.6645% -95 - C5 -1TUY 5.1 ACKA_METTE
4 PsiBlast_PDB 94.5745% -91 - C5 -1G99 5.8 ACKA_METTE
55 HHSearch 94.5050% -97 * C5 *2IIR - ACKA_THEMA -
23 PsiBlast_CBE 93.8945% -94 - C5 -1G99 6.0 ACKA_METTE
22 PsiBlast_CBE 93.3045% -94 - C5 -1TUU 4.8 ACKA_METTE
57 HHSearch 93.1544%-102 - C5 -3R9P 2.0 ACKA_MYCPA
2 PsiBlast_PDB 93.1145% -88 - C5 -1TUU 5.4 ACKA_METTE
21 PsiBlast_CBE 92.7845% -93 - C5 -1TUY 4.6 ACKA_METTE
8 PsiBlast_PDB 91.7543%-102 - C5 -4IZ9 5.7 ACKA_MYCA1
5 PsiBlast_PDB 90.8343%-100 - C5 -3R9P 2.0 ACKA_MYCPA
9 PsiBlast_PDB 90.7942%-104 - C5 -4DQ8 - ACKA_MYCMM -
7 PsiBlast_PDB 90.6743%-102 - C5 -3P4I - ACKA_MYCA1 -
6 PsiBlast_PDB 90.6742%-100 - C5 -4IJN 2.7 ACKA_MYCS2
24 PsiBlast_CBE 90.5243%-103 - C5 -3R9P 2.5 ACKA_MYCPA
25 PsiBlast_CBE 90.3442% -98 - C5 -4IJN 2.5 ACKA_MYCS2
12 PsiBlast_PDB 86.2341% -86 - C5 -3SLC - ACKA_SALTY -
27 PsiBlast_CBE 86.0741% -84 - C5 -3SLC - ACKA_SALTY -
20 PsiBlast_PDB 83.1339% -89 - C5 -4FWK 5.3 TDCD_SALTY
16 PsiBlast_PDB 83.0539% -88 - C5 -1X3N 4.9 TDCD_SALTY
13 PsiBlast_PDB 82.4639% -86 - C5 -4FWL 2.1 TDCD_SALTY
18 PsiBlast_PDB 82.3939% -88 - C5 -2E1Z 9.6 TDCD_SALTY
32 PsiBlast_CBE 82.3239% -89 - C5 -4FWP 4.4 TDCD_SALTY
15 PsiBlast_PDB 82.3239% -87 - C5 -1X3M 5.1 TDCD_SALTY
19 PsiBlast_PDB 82.2839% -89 - C5 -2E20 9.4 TDCD_SALTY
29 PsiBlast_CBE 82.1639% -85 - C5 -4FWS 5.4 TDCD_SALTY
30 PsiBlast_CBE 82.0439% -87 - C5 -4FWR 3.9 TDCD_SALTY
33 PsiBlast_CBE 82.0139% -90 - C5 -4FWO 5.9 TDCD_SALTY
14 PsiBlast_PDB 81.5639% -88 - C5 -4FWM 5.9 TDCD_SALTY
34 PsiBlast_CBE 81.3839% -85 - C5 -4FWN 7.5 TDCD_SALTY
31 PsiBlast_CBE 81.1839% -85 - C5 -4FWQ 5.8 TDCD_SALTY