@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_0977: (2015-12-19 )
MNVFEKIIQGEIPCSKILENERFLSFYDINPKAKVHALVIPKQSIQDFNGITPELMAQMTSFIFEVVEKLGIKEKGYKLLTNVGKNAGQEVMHLHFHILSGDKH

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_H_14(4ZGL)
YHIT_HELPY
[Raw transfer]




WSA_B_3(4EQH)
HINT1_HUMAN
[Raw transfer]




AMP_C_12(4ZGL)
YHIT_HELPY
[Raw transfer]




A5A_B_3(4EQG)
HINT1_HUMAN
[Raw transfer]




AMP_I_15(4ZGL)
YHIT_HELPY
[Raw transfer]




KAA_B_4(4EQE)
HINT1_HUMAN
[Raw transfer]




AMP_F_13(4ZGL)
YHIT_HELPY
[Raw transfer]




AMP_B_11(4ZGL)
YHIT_HELPY
[Raw transfer]




AP2_C_3(1AV5)
HINT1_HUMAN
[Raw transfer]




5AS_C_3(1RZY)
HINT1_RABIT
[Raw transfer]




8BR_A_2(5RHN)
HINT1_RABIT
[Raw transfer]




5GP_E_20(3N1S)
HINT_ECOLI
[Raw transfer]




AMP_C_3(1KPF)
HINT1_HUMAN
[Raw transfer]




AMP_A_3(3OMF)
HIT_ENTHI
[Raw transfer]




AMP_A_3(3TW2)
HINT1_HUMAN
[Raw transfer]




5GP_B_13(3N1S)
HINT_ECOLI
[Raw transfer]




5GP_F_22(3N1S)
HINT_ECOLI
[Raw transfer]




5GP_I_24(3N1S)
HINT_ECOLI
[Raw transfer]




5GP_A_9(3N1S)
HINT_ECOLI
[Raw transfer]




5GP_A_9(3N1S)
HINT_ECOLI
[Raw transfer]




5GP_B_6(4EGU)
?
[Raw transfer]




AMP_A_5(3O0M)
?
[Raw transfer]




5GP_C_3(3RHN)
HINT1_RABIT
[Raw transfer]




AMP_A_5(3O0M)
?
[Raw transfer]




5GP_A_3(3OXK)
HIT_ENTHI
[Raw transfer]




ADN_A_2(3O1X)
HINT1_RABIT
[Raw transfer]




ADN_A_2(3O1C)
HINT1_RABIT
[Raw transfer]




ADN_A_2(3O1C)
HINT1_RABIT
[Raw transfer]




RIB_C_3(4RHN)
HINT1_RABIT
[Raw transfer]




MPD_A_4(3R6F)
?
[Raw transfer]




EDO_A_6(3P0T)
?
[Raw transfer]




UNL_A_5(3LB5)
?
[Raw transfer]




22 PsiBlast_CBE 96.21100%-161 - C4 -4ZGL 4.9 YHIT_HELPY
23 PsiBlast_CBE 96.13100%-164 - C4 -4ZGL 4.8 YHIT_HELPY
21 PsiBlast_CBE 95.77100%-165 - C4 -4ZGL 4.7 YHIT_HELPY
25 PsiBlast_CBE 94.80100%-161 - C4 -4ZGL 4.9 YHIT_HELPY
24 PsiBlast_CBE 94.32100%-161 - C4 -4ZGL 5.6 YHIT_HELPY
1 PsiBlast_PDB 93.87100%-161 - C4 -4ZGL - YHIT_HELPY -
13 PsiBlast_PDB 76.3737%-155 - C4 -4RHN 2.9 HINT1_RABIT
32 PsiBlast_CBE 76.2337%-166 - C4 -4EQG 6.2 HINT1_HUMAN
33 PsiBlast_CBE 76.0037%-166 - C4 -4EQE 6.3 HINT1_HUMAN
31 PsiBlast_CBE 75.7537%-168 - C4 -4EQH 6.2 HINT1_HUMAN
15 PsiBlast_PDB 75.4937%-154 - C4 -6RHN - HINT1_RABIT -
20 PsiBlast_PDB 75.4737%-167 - C4 -1KPB - HINT1_HUMAN -
35 PsiBlast_CBE 75.3437%-169 - C4 -1KPE - HINT1_HUMAN -
12 PsiBlast_PDB 75.3437%-156 - C4 -3RHN 5.8 HINT1_RABIT
19 PsiBlast_PDB 75.2937%-164 - C4 -4EQH - HINT1_HUMAN -
10 PsiBlast_PDB 75.2637%-154 - C4 -1RZY 6.1 HINT1_RABIT
18 PsiBlast_PDB 75.1437%-165 - C4 -4EQG - HINT1_HUMAN -
37 PsiBlast_CBE 75.1037%-168 - C4 -1AV5 5.5 HINT1_HUMAN
26 PsiBlast_CBE 74.9944%-162 - C4 -1XQU - ? -
16 PsiBlast_PDB 74.9937%-167 - C4 -3TW2 6.1 HINT1_HUMAN
9 PsiBlast_PDB 74.9037%-152 - C4 -3O1C 4.6 HINT1_RABIT
14 PsiBlast_PDB 74.3337%-153 - C4 -5RHN 6.5 HINT1_RABIT
34 PsiBlast_CBE 73.9437%-165 - C4 -1KPF 6.3 HINT1_HUMAN
43 PsiBlast_CBE 73.8235%-150 - C4 -3N1S 6.6 HINT_ECOLI
8 PsiBlast_PDB 73.1837%-154 - C4 -3O1X 4.4 HINT1_RABIT
27 PsiBlast_CBE 72.9340%-153 - C4 -4EGU 6.1 ?
44 PsiBlast_CBE 72.9235%-144 - C4 -3N1S 6.6 HINT_ECOLI
42 PsiBlast_CBE 72.8835%-148 - C4 -3N1S 6.3 HINT_ECOLI
41 PsiBlast_CBE 72.2535%-150 - C4 -3N1S 6.4 HINT_ECOLI
45 PsiBlast_CBE 72.1535%-145 - C4 -3N1S 6.2 HINT_ECOLI
47 PsiBlast_CBE 71.0236%-149 - C4 -3O0M 5.6 ?
92 HHSearch 69.7536%-144 - C4 -3O1C 4.6 HINT1_RABIT
4 PsiBlast_PDB 69.5344%-132 - C4 -3OMF 5.6 HIT_ENTHI
5 PsiBlast_PDB 68.9144%-135 - C4 -3OXK 6.0 HIT_ENTHI
86 HHSearch 67.5033%-126 - C4 -3O0M 5.6 ?
82 HHSearch 63.2034%-116 - C4 -3N1S 6.2 HINT_ECOLI
93 HHSearch 56.0030%-119 - C4 -3R6F 2.5 ?