@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1011: (2015-12-20 )
MNKENKKVEKKELSRILIANRGEIALRAIQTIQEMGKESIAIYSIADKDAHYLNTANAKVCIGGAKSSESYLNIPAIISAAELFEADAIFPGYGFLSENQNFVEICSHHSLEFIGPSAKVMALMSDKAKAKIVMKEAGMPVIEGSDGLLKSYQEAEEIADKIGYPVIIKAAAGGGGRGMRVVGDKSKLKNLYLAAETEALSAFGDGSVYLEKFINKPKHIEVQILADKHGNVIHVGERDCSVQRRQQKLIEETPAVVLEESVRKRLLETAIKAAKYIGYVGAGTFEFLLDSNMKDFYFMEMNTRLQVEHTISEMVSGLNLIEWMIKIAQGEELPKQESFSLKGHAIECRITAEDPKKFYPSPGKITEWIAPGGVNVRLDSHAHANYVVPTNYDSMIGKLIVWGENRERAIAKMKRALKEFKVEGIKTTIPFHIEMLENADFRQAKIHTKYLEENF

Atome Classification :

(47 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_7(3G8C)
ACCC_ECOLI
[Raw transfer]




ANP_A_5(2J9G)
ACCC_ECOLI
[Raw transfer]




ATF_A_4(2VR1)
ACCC_ECOLI
[Raw transfer]




ATP_A_3(1DV2)
ACCC_ECOLI
[Raw transfer]




ATP_B_4(1DV2)
ACCC_ECOLI
[Raw transfer]




ADP_A_8(3OUZ)
?
[Raw transfer]




ADP_A_8(3OUZ)
?
[Raw transfer]




ADP_A_2(3RV4)
ACCC_ECOLI
[Raw transfer]




ADP_B_8(2J9G)
ACCC_ECOLI
[Raw transfer]




ADP_B_4(3G8D)
ACCC_ECOLI
[Raw transfer]




ADP_A_4(3RV3)
ACCC_ECOLI
[Raw transfer]




AP2_A_2(2VQD)
ACCC_PSEAE
[Raw transfer]




ANP_A_7(3OUU)
?
[Raw transfer]




ADP_A_3(3G8C)
ACCC_ECOLI
[Raw transfer]




ADP_A_4(3RUP)
ACCC_ECOLI
[Raw transfer]




ANP_A_3(2VPQ)
?
[Raw transfer]




ANP_A_3(2VPQ)
?
[Raw transfer]




ANP_B_7(2VPQ)
?
[Raw transfer]




LZL_A_3(2V5A)
ACCC_ECOLI
[Raw transfer]




LZK_B_4(2V59)
ACCC_ECOLI
[Raw transfer]




OA4_A_3(2W6P)
ACCC_ECOLI
[Raw transfer]




LZK_A_3(2V59)
ACCC_ECOLI
[Raw transfer]




LZJ_A_3(2V58)
ACCC_ECOLI
[Raw transfer]




L22_A_3(2W70)
ACCC_ECOLI
[Raw transfer]




L22_B_5(2W70)
ACCC_ECOLI
[Raw transfer]




L23_A_4(2W71)
ACCC_ECOLI
[Raw transfer]




LZJ_B_5(2V58)
ACCC_ECOLI
[Raw transfer]




GOL_A_5(3VA7)
?
[Raw transfer]




L23_C_6(2W71)
ACCC_ECOLI
[Raw transfer]




JZL_A_3(3JZI)
ACCC_ECOLI
[Raw transfer]




OA5_B_5(2W6Q)
ACCC_ECOLI
[Raw transfer]




GOL_A_5(3VA7)
?
[Raw transfer]




GOL_A_5(3VA7)
?
[Raw transfer]




JZL_B_4(3JZI)
ACCC_ECOLI
[Raw transfer]




OA2_A_3(2W6N)
ACCC_ECOLI
[Raw transfer]




L21_A_3(2W6Z)
ACCC_ECOLI
[Raw transfer]




JZK_B_4(3JZF)
ACCC_ECOLI
[Raw transfer]




OA2_B_5(2W6N)
ACCC_ECOLI
[Raw transfer]




ADP_A_3(4RZQ)
ACCC_HAEIN
[Raw transfer]




OA1_A_3(2W6M)
ACCC_ECOLI
[Raw transfer]




OA5_A_3(2W6Q)
ACCC_ECOLI
[Raw transfer]




OA1_B_5(2W6M)
ACCC_ECOLI
[Raw transfer]




OA3_A_3(2W6O)
ACCC_ECOLI
[Raw transfer]




OA3_C_5(2W6O)
ACCC_ECOLI
[Raw transfer]




ADP_A_3(3RUP)
ACCC_ECOLI
[Raw transfer]




ADP_B_9(3RUP)
ACCC_ECOLI
[Raw transfer]




ADP_B_7(3RV3)
ACCC_ECOLI
[Raw transfer]




115 HHSearch 89.5666% -91 - C1 -3OUZ 5.4 ?
1 PsiBlast_PDB 89.4264% -96 - C1 -3OUZ 5.4 ?
2 PsiBlast_PDB 86.8464% -95 - C1 -3OUU 7.2 ?
18 PsiBlast_PDB 85.3951% -92 - C1 -2W6O 4.0 ACCC_ECOLI
30 PsiBlast_CBE 85.3151% -90 - C1 -2W71 6.1 ACCC_ECOLI
29 PsiBlast_CBE 84.7751% -91 - C1 -2W71 6.6 ACCC_ECOLI
34 PsiBlast_CBE 84.2551% -91 - C1 -2W6Z 4.6 ACCC_ECOLI
37 PsiBlast_CBE 84.2251% -89 - C1 -2W6N 5.4 ACCC_ECOLI
19 PsiBlast_PDB 84.2251% -90 - C1 -2W6P 4.4 ACCC_ECOLI
52 PsiBlast_CBE 84.1951% -92 - C1 -3G8D 5.3 ACCC_ECOLI
38 PsiBlast_CBE 83.8151% -89 - C1 -2W6M 4.0 ACCC_ECOLI
35 PsiBlast_CBE 83.7751% -89 - C1 -2W6Q 5.0 ACCC_ECOLI
17 PsiBlast_PDB 83.6951% -90 - C1 -2W6N 5.9 ACCC_ECOLI
31 PsiBlast_CBE 83.5651% -89 - C1 -2W70 3.6 ACCC_ECOLI
28 PsiBlast_CBE 83.5651% -94 - C1 -4HR7 - ACCC_ECOLI -
15 PsiBlast_PDB 83.4451% -90 - C1 -2V5A 4.8 ACCC_ECOLI
32 PsiBlast_CBE 83.3451% -90 - C1 -2W70 3.8 ACCC_ECOLI
54 PsiBlast_CBE 83.3251% -89 * C1 *3RV4 8.3 ACCC_ECOLI
12 PsiBlast_PDB 83.1651% -93 - C1 -2VR1 5.6 ACCC_ECOLI
50 PsiBlast_CBE 83.1251% -90 - C1 -1DV2 4.5 ACCC_ECOLI
20 PsiBlast_PDB 83.1151% -89 - C1 -2W6Q 4.3 ACCC_ECOLI
41 PsiBlast_CBE 83.0751% -90 - C1 -2V59 4.3 ACCC_ECOLI
16 PsiBlast_PDB 82.9951% -89 - C1 -2W6M 4.0 ACCC_ECOLI
14 PsiBlast_PDB 82.9151% -91 - C1 -2V59 3.9 ACCC_ECOLI
23 PsiBlast_CBE 82.8851% -87 - C1 -3JZI 9.3 ACCC_ECOLI
24 PsiBlast_CBE 82.8551% -88 - C1 -3JZF 8.9 ACCC_ECOLI
48 PsiBlast_CBE 82.7451% -89 - C1 -3G8C 5.3 ACCC_ECOLI
13 PsiBlast_PDB 82.7451% -88 - C1 -2V58 5.2 ACCC_ECOLI
43 PsiBlast_CBE 82.2551% -91 - C1 -2J9G 6.5 ACCC_ECOLI
44 PsiBlast_CBE 82.2251% -90 - C1 -3RV3 6.3 ACCC_ECOLI
51 PsiBlast_CBE 82.1151% -92 - C1 -1DV2 5.2 ACCC_ECOLI
42 PsiBlast_CBE 82.1151% -90 - C1 -2V58 5.5 ACCC_ECOLI
11 PsiBlast_PDB 81.9951% -91 - C1 -2J9G 5.3 ACCC_ECOLI
36 PsiBlast_CBE 81.7051% -91 - C1 -2W6O 3.7 ACCC_ECOLI
21 PsiBlast_CBE 81.3051% -87 - C1 -2VPQ 6.1 ?
8 PsiBlast_PDB 81.2851% -88 - C1 -3JZI 8.5 ACCC_ECOLI
49 PsiBlast_CBE 81.2351% -87 - C1 -3G8C 5.9 ACCC_ECOLI
47 PsiBlast_CBE 81.0551% -87 - C1 -3RUP 7.3 ACCC_ECOLI
45 PsiBlast_CBE 81.0451% -89 - C1 -3RV3 7.8 ACCC_ECOLI
3 PsiBlast_PDB 80.8951% -87 - C1 -2VPQ 7.0 ?
116 HHSearch 80.4351% -84 - C1 -2VPQ 7.0 ?
46 PsiBlast_CBE 80.0551% -87 - C1 -3RUP 6.8 ACCC_ECOLI
6 PsiBlast_PDB 79.1750% -92 - C1 -4RZQ 3.8 ACCC_HAEIN
4 PsiBlast_PDB 79.0651% -86 - C1 -2VQD 7.4 ACCC_PSEAE
101 PsiBlast_CBE 68.9640% -90 - C1 -3VA7 2.1 ?
124 HHSearch 68.7640% -88 - C1 -3VA7 2.1 ?
106 Fugue 65.3539% -87 - C1 -3VA7 2.1 ?