Study : jhp_1104 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: 6MP_O_15(1OU4) / Model_36(1OU4/B) = [3.1] Download589.8313.53MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS
Complex: 6MP_Q_17(1OU4) / Model_35(1OU4/C) = [3.2] Download322.178.31MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS
Complex: 6MP_M_13(1OTY) / Model_37(1OTY/C) = [3.2] Download411.808.31MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS
Complex: 6MP_O_15(1OTY) / Model_38(1OTY/B) = [3.4] Download515.4713.53MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS
Complex: 6MP_M_13(1OU4) / Model_11(1OU4/A) = [3.5] Download470.8514.69MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS
Consensus
[pKd Mean = 3.28]
-462
(s=90)
11
(s=2)
MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS