@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1104: (2015-12-20 )
MTPHINAKIGDFYPQCLLCGDPLRVSYIAKNFLQDAKEITNVRNMLGFSGKYKGKGISLMGHGMGIASCTIYVTELIKTYQVKELLRIGTCGAISPKVGLKDIVMATGASTDSKTNRVRFLNHDLSATPDFELSLRAYQTAKRLGIDLKIGNVFSSDFFYSFETHAFGLMAQYNHLAIEMEAAGLYATAMELNAKALCLCSVSDHLITKEALSPKERIESFDNMITLALEMMS

Atome Classification :

(69 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMC_A_4(3UT6)
DEOD_ECOLI
[Raw transfer]




ADN_Q_17(1PK7)
DEOD_ECO57
[Raw transfer]




FMC_C_9(4TS9)
?
[Raw transfer]




FMC_B_7(4TS9)
?
[Raw transfer]




FMC_A_4(4TS9)
?
[Raw transfer]




2FA_M_13(1PK9)
DEOD_ECO57
[Raw transfer]




TBN_Q_17(1PR5)
DEOD_ECO57
[Raw transfer]




FMC_B_6(3UT6)
DEOD_ECOLI
[Raw transfer]




ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




XYA_M_13(1PR6)
DEOD_ECO57
[Raw transfer]




FMC_C_9(3UT6)
DEOD_ECOLI
[Raw transfer]




2FA_Q_17(1PK9)
DEOD_ECO57
[Raw transfer]




NOS_Q_17(1PR0)
DEOD_ECO57
[Raw transfer]




FMB_Q_17(1PR1)
DEOD_ECO57
[Raw transfer]




XYA_Q_17(1PR6)
DEOD_ECO57
[Raw transfer]




2FA_O_15(1PK9)
DEOD_ECO57
[Raw transfer]




NOS_O_15(1PR0)
DEOD_ECO57
[Raw transfer]




TBN_M_13(1PR5)
DEOD_ECO57
[Raw transfer]




TBN_O_15(1PR5)
DEOD_ECO57
[Raw transfer]




ADN_M_13(1PK7)
DEOD_ECO57
[Raw transfer]




MTP_Q_17(1PR4)
DEOD_ECO57
[Raw transfer]




NOS_M_13(1PR0)
DEOD_ECO57
[Raw transfer]




FMB_B_7(1A69)
DEOD_ECOLI
[Raw transfer]




XYA_O_15(1PR6)
DEOD_ECO57
[Raw transfer]




TAL_O_15(1OUM)
DEOD_ECOLI
[Raw transfer]




FMB_M_13(1PR1)
DEOD_ECO57
[Raw transfer]




ADN_O_15(1PK7)
DEOD_ECO57
[Raw transfer]




RAB_O_15(1PW7)
DEOD_ECO57
[Raw transfer]




TAL_K_11(1OUM)
DEOD_ECOLI
[Raw transfer]




FMB_O_15(1PR1)
DEOD_ECO57
[Raw transfer]




FMB_C_9(1A69)
DEOD_ECOLI
[Raw transfer]




MDR_O_15(1OVG)
DEOD_ECOLI
[Raw transfer]




MTP_O_15(1PR4)
DEOD_ECO57
[Raw transfer]




RAB_Q_17(1PW7)
DEOD_ECO57
[Raw transfer]




TAL_M_13(1OUM)
DEOD_ECOLI
[Raw transfer]




2FD_O_15(1PKE)
DEOD_ECO57
[Raw transfer]




MTP_M_13(1PR4)
DEOD_ECO57
[Raw transfer]




2FD_Q_17(1PKE)
DEOD_ECO57
[Raw transfer]




RAB_M_13(1PW7)
DEOD_ECO57
[Raw transfer]




2FD_G_7(1Z34)
?
[Raw transfer]




MDR_M_13(1OVG)
DEOD_ECOLI
[Raw transfer]




2FD_M_13(1PKE)
DEOD_ECO57
[Raw transfer]




DBM_Q_17(1OV6)
DEOD_ECOLI
[Raw transfer]




MDR_Q_17(1PR2)
DEOD_ECO57
[Raw transfer]




MDR_O_15(1PR2)
DEOD_ECO57
[Raw transfer]




MDR_M_13(1PR2)
DEOD_ECO57
[Raw transfer]




MDR_Q_17(1OVG)
DEOD_ECOLI
[Raw transfer]




DBM_M_13(1OV6)
DEOD_ECOLI
[Raw transfer]




DBM_O_15(1OV6)
DEOD_ECOLI
[Raw transfer]




6MP_Q_17(1OU4)
DEOD_ECOLI
[Raw transfer]




6MP_M_13(1OTY)
DEOD_ECOLI
[Raw transfer]




6MP_M_13(1OU4)
DEOD_ECOLI
[Raw transfer]




6MP_Q_17(1OTY)
DEOD_ECOLI
[Raw transfer]




6MP_O_15(1OU4)
DEOD_ECOLI
[Raw transfer]




6MP_O_15(1OTY)
DEOD_ECOLI
[Raw transfer]




12 PsiBlast_PDB 96.4454%-127 - C2 -1K9S - DEOD_ECOLI -
66 PsiBlast_CBE 96.0354%-131 - C2 -3OOH - DEOD_ECOLI -
87 PsiBlast_CBE 95.7354%-126 - C2 -1K9S - DEOD_ECOLI -
20 PsiBlast_PDB 95.5354%-123 - C2 -4RJ2 - ? -
41 PsiBlast_CBE 95.5254%-127 - C2 -4TS3 - ? -
27 PsiBlast_CBE 95.5054%-128 - C2 -1PR4 4.8 DEOD_ECO57
50 PsiBlast_CBE 95.3954%-123 - C2 -4RJ2 - ? -
97 PsiBlast_CBE 95.3653%-126 - C2 -1OUM 5.2 DEOD_ECOLI
77 PsiBlast_CBE 95.3454%-126 - C2 -3ONV - DEOD_ECOLI -
71 PsiBlast_CBE 95.3354%-129 - C2 -3OOE - DEOD_ECOLI -
88 PsiBlast_CBE 95.3054%-128 - C2 -1K9S - DEOD_ECOLI -
53 PsiBlast_CBE 95.2654%-125 - C2 -3UT6 4.3 DEOD_ECOLI
38 PsiBlast_CBE 95.2554%-126 - C2 -1OTY 3.4 DEOD_ECOLI
16 PsiBlast_PDB 95.2354%-126 - C2 -3ONV - DEOD_ECOLI -
46 PsiBlast_CBE 95.2154%-126 - C2 -4TS3 - ? -
18 PsiBlast_PDB 95.1354%-129 - C2 -3OOH - DEOD_ECOLI -
17 PsiBlast_PDB 95.0854%-125 - C2 -3OOE - DEOD_ECOLI -
74 PsiBlast_CBE 95.0554%-128 - C2 -3OOE - DEOD_ECOLI -
14 PsiBlast_PDB 95.0254%-124 - C2 -1PK9 5.3 DEOD_ECO57
80 PsiBlast_CBE 94.9654%-127 - C2 -1PK9 5.5 DEOD_ECO57
19 PsiBlast_PDB 94.8654%-125 - C2 -3UT6 4.5 DEOD_ECOLI
7 PsiBlast_PDB 94.7754%-125 - C2 -1PW7 4.3 DEOD_ECO57
6 PsiBlast_PDB 94.6754%-129 - C2 -1PR6 4.8 DEOD_ECO57
28 PsiBlast_CBE 94.5154%-124 - C2 -1PR4 5.0 DEOD_ECO57
4 PsiBlast_PDB 94.4354%-128 - C2 -1PR4 5.1 DEOD_ECO57
52 PsiBlast_CBE 94.3654%-125 - C2 -3UT6 4.4 DEOD_ECOLI
23 PsiBlast_CBE 94.3654%-131 - C2 -1PR6 4.9 DEOD_ECO57
82 PsiBlast_CBE 94.2454%-130 - C2 -1PK7 5.1 DEOD_ECO57
81 PsiBlast_CBE 94.0654%-124 - C2 -1PK9 5.2 DEOD_ECO57
15 PsiBlast_PDB 94.0654%-124 - C2 -1PKE 4.9 DEOD_ECO57
3 PsiBlast_PDB 94.0654%-123 - C2 -1PR2 5.0 DEOD_ECO57
1 PsiBlast_PDB 94.0654%-124 - C2 -1PR0 4.8 DEOD_ECO57
102 PsiBlast_CBE 93.9953%-123 - C2 -4TS9 4.4 ?
36 PsiBlast_CBE 93.9854%-125 - C2 -1OU4 3.1 DEOD_ECOLI
89 PsiBlast_CBE 93.9453%-128 - C2 -1OVG 5.0 DEOD_ECOLI
24 PsiBlast_CBE 93.9054%-125 - C2 -1PR6 4.7 DEOD_ECO57
93 PsiBlast_CBE 93.8253%-123 - C2 -1OV6 5.6 DEOD_ECOLI
29 PsiBlast_CBE 93.8254%-122 - C2 -1PR2 5.3 DEOD_ECO57
39 PsiBlast_CBE 93.7954%-131 - C2 -1A69 4.3 DEOD_ECOLI
95 PsiBlast_CBE 93.6953%-127 - C2 -1OUM 5.9 DEOD_ECOLI
22 PsiBlast_CBE 93.6154%-126 - C2 -1PW7 4.3 DEOD_ECO57
21 PsiBlast_CBE 93.5854%-126 - C2 -1PW7 4.1 DEOD_ECO57
91 PsiBlast_CBE 93.5653%-121 - C2 -1OVG 5.4 DEOD_ECOLI
13 PsiBlast_PDB 93.5654%-125 - C2 -1PK7 4.6 DEOD_ECO57
30 PsiBlast_CBE 93.4954%-123 - C2 -1PR2 5.1 DEOD_ECO57
92 PsiBlast_CBE 93.4353%-127 - C2 -1OV6 5.0 DEOD_ECOLI
90 PsiBlast_CBE 93.4353%-124 - C2 -1OVG 5.2 DEOD_ECOLI
35 PsiBlast_CBE 93.3354%-129 - C2 -1OU4 3.2 DEOD_ECOLI
32 PsiBlast_CBE 93.3354%-123 - C2 -1PR1 4.5 DEOD_ECO57
11 PsiBlast_PDB 93.3354%-125 - C2 -1OU4 3.5 DEOD_ECOLI
40 PsiBlast_CBE 93.3154%-125 - C2 -1A69 4.7 DEOD_ECOLI
34 PsiBlast_CBE 93.1954%-123 - C2 -1PR0 4.5 DEOD_ECO57
78 PsiBlast_CBE 92.9754%-130 - C2 -1PKE 5.0 DEOD_ECO57
79 PsiBlast_CBE 92.9654%-125 - C2 -1PKE 4.4 DEOD_ECO57
37 PsiBlast_CBE 92.9454%-123 - C2 -1OTY 3.2 DEOD_ECOLI
103 PsiBlast_CBE 92.8153%-127 - C2 -4TS9 4.6 ?
10 PsiBlast_PDB 92.6254%-122 - C2 -1OTY 3.8 DEOD_ECOLI
83 PsiBlast_CBE 92.4254%-124 - C2 -1PK7 4.6 DEOD_ECO57
5 PsiBlast_PDB 92.4254%-125 - C2 -1PR5 4.3 DEOD_ECO57
96 PsiBlast_CBE 92.3853%-123 - C2 -1OUM 5.6 DEOD_ECOLI
33 PsiBlast_CBE 92.2854%-123 - C2 -1PR0 5.2 DEOD_ECO57
101 PsiBlast_CBE 92.2153%-123 - C2 -4TS9 4.4 ?
94 PsiBlast_CBE 92.0653%-123 - C2 -1OV6 5.7 DEOD_ECOLI
31 PsiBlast_CBE 91.6954%-122 - C2 -1PR1 4.5 DEOD_ECO57
26 PsiBlast_CBE 91.6154%-127 - C2 -1PR5 4.7 DEOD_ECO57
2 PsiBlast_PDB 91.5554%-126 - C2 -1PR1 4.3 DEOD_ECO57
109 HHSearch 90.3447%-122 - C2 -1Z34 4.6 ?
25 PsiBlast_CBE 89.0454%-120 - C2 -1PR5 4.9 DEOD_ECO57
110 HHSearch 84.4042%-116 - C2 -3UAW 5.0 DEOD_BACCE