@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1120: (2015-12-21 )
MPTINQLIRKERKKVVKKTKSPALVECPQRRGVCTRVYTTTPKKPNSALRKVAKVRLTSKFEVISYIPGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDTAGVNKRTVSRSKYGTKKAKATDKKATDNKKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_X_22(4JV5)
RS12_THET8
[Raw transfer]
-
3 PsiBlast_PDB 93.0877% -61 - C5 -4KHP - RS12_THET8 -
60 Fugue 91.8175% -59 - C5 -1FJG - RS12_THET8 -
27 PsiBlast_CBE 91.8177% -60 - C5 -3T1Y - RS12_THET8 -
11 PsiBlast_PDB 91.7577% -56 - C5 -4GKK - RS12_THET8 -
4 PsiBlast_PDB 91.5677% -65 - C5 -4JV5 3.7 RS12_THET8
10 PsiBlast_PDB 91.3277% -60 - C5 -4GKJ - RS12_THET8 -
57 PsiBlast_CBE 91.2575% -69 - C5 -4JI8 - RS12_THET8 -
1 PsiBlast_PDB 91.2574% -64 - C5 -4OX9 - RS12_THET8 -
25 PsiBlast_CBE 91.1077% -68 - C5 -4B3R - RS12_THET8 -
12 PsiBlast_PDB 90.9777% -62 - C5 -4WT8 - RS12_THET8 -
13 PsiBlast_PDB 90.2677% -66 - C5 -4YHH - RS12_THET8 -
26 PsiBlast_CBE 89.9177% -68 - C5 -4B3M - RS12_THET8 -
59 PsiBlast_CBE 89.4875% -68 - C5 -4JI3 - RS12_THET8 -
23 PsiBlast_CBE 89.3277% -66 - C5 -4B3T - RS12_THET8 -
30 PsiBlast_CBE 89.3176% -70 - C5 -4AQY - RS12_THET8 -
43 PsiBlast_CBE 88.7576% -73 - C5 -1N34 - RS12_THET8 -
36 PsiBlast_CBE 88.3776% -66 - C5 -2UUB - RS12_THET8 -
20 PsiBlast_PDB 88.3772% -66 - C5 -4A2I - RS12_ECOLI -
32 PsiBlast_CBE 88.0376% -56 - C5 -2VQE - RS12_THET8 -
9 PsiBlast_PDB 87.6977% -57 - C5 -3IZZ - ? -