@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1122: (2015-12-21 )
MAISKEEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILADSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVEVK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TBR_A_5(1DD4)
?
[Raw transfer]




TBR_A_6(1DD4)
?
[Raw transfer]




39 Fugue 90.0760% -77 - C3 -1DD3 - RL7_THEMA -
25 HHSearch 89.6861% -71 - C3 -1DD3 - RL7_THEMA -
6 PsiBlast_PDB 89.0661% -83 - C3 -1DD3 - RL7_THEMA -
7 PsiBlast_PDB 87.7361% -75 - C3 -1DD4 4.9 ?
21 PsiBlast_CBE 86.5361% -80 - C3 -1DD4 5.5 ?
3 PsiBlast_PDB 80.6065% -61 - C3 -1RQS - RL7_ECOLI -
26 HHSearch 77.3866% -72 - C3 -1CTF - RL7_ECOLI -
4 PsiBlast_PDB 77.1965% -72 - C3 -1CTF - RL7_ECOLI -
2 PsiBlast_PDB 76.8352% -55 - C3 -1RQV - RL7_ECOLI -
1 PsiBlast_PDB 76.5152% -68 - C3 -1RQU - RL7_ECOLI -
42 Fugue 75.7870% -74 - C3 -1DD3 - RL7_THEMA -
33 HHSearch 55.8317% -41 - C3 -2W9R - CLPS_ECOLI -
22 HHSearch 52.5330% 164 - C- -2FTC - RM12_BOVIN -
30 HHSearch 52.5218% -57 - C3 -3O1F - CLPS_ECOLI -
8 PsiBlast_PDB 46.4629% 146 - C- -2FTC - RM12_BOVIN -
14 PsiBlast_PDB 43.6123% 83 - C- -2IY3 - SRP54_SULSO (first) -
28 HHSearch 42.1252% -24 - C3 -1ZAV - ? -
20 PsiBlast_PDB 41.8735% 31 - C3 -3AUU - DHG4_BACME -
11 PsiBlast_PDB 41.2155% -30 - C3 -1ZAV - ? -
19 PsiBlast_PDB 40.7135% 38 - C3 -3AUT - DHG4_BACME -