@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1142: (2015-12-21 )
MDSTLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILRLENDTRYFKDFTQVLALNYGSKNELSRAFKSLLENPPNHINNIESLENEISHRLDTHDLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELKC

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GPP_D_19(2VG3)
DPDS_MYCTU
[Raw transfer]




B08_A_3(2E99)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




FPS_C_3(1X08)
UPPS_ECOLI
[Raw transfer]




H78_A_3(3WYJ)
UPPS_ECOLI
[Raw transfer]




GPP_A_6(2VG3)
DPDS_MYCTU
[Raw transfer]




IPE_A_3(1X09)
UPPS_ECOLI
[Raw transfer]




FPP_A_3(4H8E)
ISPT_STAAN
[Raw transfer]




IPE_A_4(1X07)
UPPS_ECOLI
[Raw transfer]




DPO_C_3(2DTN)
ISPT_HELPY
[Raw transfer]




40B_B_4(4ONC)
DPDS_MYCTU
[Raw transfer]




B75_A_3(2E9C)
UPPS_ECOLI
[Raw transfer]




DPO_C_20(2VG2)
DPDS_MYCTU
[Raw transfer]




B29_A_3(2E98)
UPPS_ECOLI
[Raw transfer]




FPS_A_4(1X06)
UPPS_ECOLI
[Raw transfer]




FPP_A_4(4Q9M)
ISPT_STRR6
[Raw transfer]




B75_B_5(2E9C)
UPPS_ECOLI
[Raw transfer]




FPS_A_3(4U82)
ISPT_STAAN
[Raw transfer]




GPP_B_9(2VG3)
DPDS_MYCTU
[Raw transfer]




DPO_A_5(2VG2)
DPDS_MYCTU
[Raw transfer]




FPP_B_15(4Q9M)
ISPT_STRR6
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




FPP_C_3(1V7U)
UPPS_ECOLI
[Raw transfer]




GPP_C_15(2VG3)
DPDS_MYCTU
[Raw transfer]




2BJ_B_4(3SGV)
UPPS_ECOLI
[Raw transfer]




B28_B_5(2E9A)
UPPS_ECOLI
[Raw transfer]




B76_A_3(2E9D)
UPPS_ECOLI
[Raw transfer]




2BJ_A_5(3SGV)
UPPS_ECOLI
[Raw transfer]




TH9_B_3(3TH8)
UPPS_ECOLI
[Raw transfer]




40B_A_3(4ONC)
DPDS_MYCTU
[Raw transfer]




B08_A_5(2E99)
UPPS_ECOLI
[Raw transfer]




GOL_B_19(2VG2)
DPDS_MYCTU
[Raw transfer]




B29_A_4(2E98)
UPPS_ECOLI
[Raw transfer]




0FW_A_4(3SGX)
UPPS_ECOLI
[Raw transfer]




IPE_A_4(1X09)
UPPS_ECOLI
[Raw transfer]




B29_A_5(2E98)
UPPS_ECOLI
[Raw transfer]




FFT_A_4(3UGS)
ISPT_CAMJE
[Raw transfer]




IPE_B_15(2VG2)
DPDS_MYCTU
[Raw transfer]




B28_A_4(2E9A)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




B08_B_7(2E99)
UPPS_ECOLI
[Raw transfer]




IPE_A_6(2VG2)
DPDS_MYCTU
[Raw transfer]




SAX_B_3(3SH0)
UPPS_ECOLI
[Raw transfer]




FFT_B_3(3UGS)
ISPT_CAMJE
[Raw transfer]




P09_B_3(3SGT)
UPPS_ECOL6
[Raw transfer]




0YZ_A_4(4H3C)
UPPS_ECOLI
[Raw transfer]




B29_B_8(2E98)
UPPS_ECOLI
[Raw transfer]




2BJ_A_7(3SGV)
UPPS_ECOLI
[Raw transfer]




0YW_B_4(4H2O)
UPPS_ECOLI
[Raw transfer]




B75_A_6(2E9C)
UPPS_ECOLI
[Raw transfer]




PGE_A_3(5CQB)
?
[Raw transfer]




OXN_B_11(1UEH)
UPPS_ECOLI
[Raw transfer]




EGC_A_3(1JP3)
UPPS_ECOLI
[Raw transfer]




2 PsiBlast_PDB 97.5294%-109 - C8 -2DTN - ISPT_HELPY -
21 PsiBlast_CBE 96.8894%-107 - C8 -2DTN 4.7 ISPT_HELPY
1 PsiBlast_PDB 96.5194%-110 - C8 -2D2R - ISPT_HELPY -
85 HHSearch 95.5094%-106 - C8 -2D2R - ISPT_HELPY -
4 PsiBlast_PDB 84.1142% -92 - C8 -1V7U 5.0 UPPS_ECOLI
43 PsiBlast_CBE 83.8042% -93 - C8 -1X08 7.3 UPPS_ECOLI
34 PsiBlast_CBE 83.6642% -96 - C8 -2E9D - UPPS_ECOLI -
40 PsiBlast_CBE 83.3342% -93 - C8 -1UEH 3.5 UPPS_ECOLI
49 PsiBlast_CBE 83.2539% -84 - C8 -4H8E 9.4 ISPT_STAAN
48 PsiBlast_CBE 83.0239% -82 - C8 -4U82 9.0 ISPT_STAAN
38 PsiBlast_CBE 83.0242%-100 - C8 -2E98 4.7 UPPS_ECOLI
39 PsiBlast_CBE 82.9842% -99 - C8 -1V7U - UPPS_ECOLI -
55 PsiBlast_CBE 82.9437% -84 - C8 -4ONC 4.5 DPDS_MYCTU
37 PsiBlast_CBE 82.8842%-101 - C8 -2E99 4.7 UPPS_ECOLI
17 PsiBlast_PDB 82.8042%-101 - C8 -3SH0 6.2 UPPS_ECOLI
5 PsiBlast_PDB 82.5742% -91 - C8 -1X06 8.8 UPPS_ECOLI
42 PsiBlast_CBE 82.5042% -92 - C8 -1X09 5.0 UPPS_ECOLI
36 PsiBlast_CBE 82.4442% -99 - C8 -2E9A 3.9 UPPS_ECOLI
30 PsiBlast_CBE 82.3142% -97 - C8 -3WYJ 9.4 UPPS_ECOLI
6 PsiBlast_PDB 82.1442% -95 - C8 -1X07 6.0 UPPS_ECOLI
81 HHSearch 82.0542% -94 * C8 *3SGV 5.4 UPPS_ECOLI
64 PsiBlast_CBE 81.8937% -80 - C8 -2VG2 3.1 DPDS_MYCTU
14 PsiBlast_PDB 81.7542% -95 - C8 -3SGT 5.0 UPPS_ECOL6
33 PsiBlast_CBE 81.5942% -95 - C8 -3SGV 6.6 UPPS_ECOLI
56 PsiBlast_CBE 81.5637% -83 - C8 -4ONC 7.5 DPDS_MYCTU
62 PsiBlast_CBE 81.5337% -84 - C8 -2VG2 3.8 DPDS_MYCTU
35 PsiBlast_CBE 81.4842% -93 - C8 -2E9C 6.7 UPPS_ECOLI
61 PsiBlast_CBE 81.3237% -84 - C8 -2VG2 2.6 DPDS_MYCTU
58 PsiBlast_CBE 81.1637% -83 - C8 -2VG3 7.3 DPDS_MYCTU
44 PsiBlast_CBE 81.1641%-108 - C8 -3UGS 5.6 ISPT_CAMJE
15 PsiBlast_PDB 81.0142%-100 - C8 -3SGV 5.4 UPPS_ECOLI
60 PsiBlast_CBE 80.8737% -81 - C8 -2VG3 8.0 DPDS_MYCTU
8 PsiBlast_PDB 80.8042% -87 - C8 -2E99 5.9 UPPS_ECOLI
57 PsiBlast_CBE 80.7837% -85 - C8 -2VG3 7.0 DPDS_MYCTU
84 HHSearch 80.7342%-100 - C8 -3UGS 5.6 ISPT_CAMJE
63 PsiBlast_CBE 80.5937% -81 - C8 -2VG2 4.2 DPDS_MYCTU
59 PsiBlast_CBE 80.5337% -81 - C8 -2VG3 8.1 DPDS_MYCTU
45 PsiBlast_CBE 80.5241%-114 - C8 -3UGS 6.0 ISPT_CAMJE
7 PsiBlast_PDB 80.2742% -93 - C8 -2E98 7.3 UPPS_ECOLI
16 PsiBlast_PDB 80.2642% -95 - C8 -3SGX 5.3 UPPS_ECOLI
11 PsiBlast_PDB 79.8742% -94 - C8 -2E9D 4.6 UPPS_ECOLI
54 PsiBlast_CBE 79.7237% -81 - C8 -4Q9M 8.6 ISPT_STRR6
24 PsiBlast_CBE 79.6242% -94 - C8 -4H3C 4.5 UPPS_ECOLI
31 PsiBlast_CBE 79.5242% -90 - C8 -3TH8 4.9 UPPS_ECOLI
83 HHSearch 79.4637% -79 - C8 -2VG3 8.0 DPDS_MYCTU
53 PsiBlast_CBE 79.2637% -83 - C8 -4Q9M 8.6 ISPT_STRR6
9 PsiBlast_PDB 79.2542% -95 - C8 -2E9A 6.1 UPPS_ECOLI
20 PsiBlast_PDB 79.2142% -90 - C8 -4H2O 3.7 UPPS_ECOLI
10 PsiBlast_PDB 79.0842% -97 - C8 -2E9C 6.2 UPPS_ECOLI
41 PsiBlast_CBE 78.2342% -96 - C8 -5CQB 1.6 ?
72 Fugue 78.0139% -81 - C8 -1JP3 2.2 UPPS_ECOLI