Study : jhp_1153 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: B62_A_3(3H2N) / Model_49(3H2N/A) = [3.1] Download629.2716.80MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD
Complex: B52_A_3(3H21) / Model_12(3H21/A) = [3.2] Download1153.759.90MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD
Complex: 680_O_15(1TX2) / Model_55(1TX2/B) = [3.3] Download302.7219.88MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD
Complex: 680_P_16(1TX2) / Model_11(1TX2/A) = [3.4] Download563.8812.20MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD
Complex: XHP_B_7(3TYZ) / Model_23(3TYZ/B) = [3.4] Download403.5010.67MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD
Consensus
[pKd Mean = 3.28]
-610
(s=295)
13
(s=3)
MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD