@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1153: (2015-12-21 )
MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PH_C_3(1AJ2)
DHPS_ECOLI
[Raw transfer]




HH2_A_3(3TZF)
?
[Raw transfer]




HH2_B_5(3TZF)
?
[Raw transfer]




HH2_A_11(1TWW)
?
[Raw transfer]




78H_A_3(3TYA)
?
[Raw transfer]




HH2_D_4(2DZB)
?
[Raw transfer]




78H_B_8(3TYA)
?
[Raw transfer]




XTZ_A_3(3TYE)
?
[Raw transfer]




PMM_A_3(1EYE)
DHPS1_MYCTU
[Raw transfer]




PT1_O_15(1TX0)
?
[Raw transfer]




PT1_P_16(1TX0)
?
[Raw transfer]




PT1_A_3(3TYU)
?
[Raw transfer]




0J2_A_7(4D8Z)
?
[Raw transfer]




PMM_N_14(1TWZ)
?
[Raw transfer]




B63_A_3(3H2O)
?
[Raw transfer]




PH2_C_3(1AJ0)
DHPS_ECOLI
[Raw transfer]




B57_A_3(3H2A)
?
[Raw transfer]




XHP_A_3(3TYZ)
?
[Raw transfer]




0HY_A_7(4D8A)
?
[Raw transfer]




PMM_M_13(1TWZ)
?
[Raw transfer]




B55_A_3(3H24)
?
[Raw transfer]




XHP_B_10(3TYC)
?
[Raw transfer]




0J5_B_8(4DAI)
?
[Raw transfer]




XHP_B_8(3TYB)
?
[Raw transfer]




680_O_15(1TX2)
?
[Raw transfer]




680_P_16(1TX2)
?
[Raw transfer]




XHP_A_4(3TYD)
?
[Raw transfer]




PH2_C_3(1AJ0)
DHPS_ECOLI
[Raw transfer]




XHP_B_7(3TYZ)
?
[Raw transfer]




B53_A_3(3H22)
?
[Raw transfer]




XHP_B_12(3TYD)
?
[Raw transfer]




Z17_B_14(4D9P)
?
[Raw transfer]




0J5_A_3(4DAI)
?
[Raw transfer]




B61_A_3(3H2M)
?
[Raw transfer]




B52_A_3(3H21)
?
[Raw transfer]




XHP_A_3(3TYB)
?
[Raw transfer]




0J2_B_13(4D8Z)
?
[Raw transfer]




B62_A_3(3H2N)
?
[Raw transfer]




B55_B_9(3H24)
?
[Raw transfer]




B57_B_7(3H2A)
?
[Raw transfer]




Z25_A_3(4DB7)
?
[Raw transfer]




B56_A_3(3H26)
?
[Raw transfer]




B61_B_8(3H2M)
?
[Raw transfer]




B62_B_8(3H2N)
?
[Raw transfer]




B54_A_3(3H23)
?
[Raw transfer]




Z17_A_8(4D9P)
?
[Raw transfer]




B60_A_3(3H2F)
?
[Raw transfer]




B58_B_9(3H2C)
?
[Raw transfer]




61 HHSearch 90.5232%-106 - C4 -2DQW - ? -
21 PsiBlast_CBE 90.0932%-115 - C4 -2DZB 4.1 ?
62 HHSearch 88.8928% -83 - C4 -2BMB - FOL1_YEAST -
6 PsiBlast_PDB 88.2633% -89 - C4 -1AJZ - DHPS_ECOLI -
5 PsiBlast_PDB 87.0133% -90 - C4 -1AJ2 5.9 DHPS_ECOLI
39 PsiBlast_CBE 86.0231%-108 - C4 -3TYE 6.3 ?
66 HHSearch 85.7332% -90 - C4 -1AJ0 3.7 DHPS_ECOLI
40 PsiBlast_CBE 85.7231%-113 - C4 -3TYD 3.4 ?
1 PsiBlast_PDB 85.7034% -95 - C4 -3TYU 5.6 ?
3 PsiBlast_PDB 85.5734% -89 - C4 -3TZF 6.5 ?
22 PsiBlast_CBE 85.4534% -91 - C4 -3TZF 6.2 ?
52 PsiBlast_CBE 85.3731%-112 - C4 -3H2C 3.7 ?
4 PsiBlast_PDB 85.3133% -89 - C4 -1AJ0 3.6 DHPS_ECOLI
49 PsiBlast_CBE 84.7531%-109 - C4 -3H2N 3.1 ?
57 PsiBlast_CBE 84.6431%-108 * C4 *1TWZ 3.8 ?
45 PsiBlast_CBE 84.5031%-108 - C4 -3TYA 4.5 ?
2 PsiBlast_PDB 84.5034% -87 - C4 -3TYZ 3.5 ?
53 PsiBlast_CBE 84.4531%-110 - C4 -3H2A 3.8 ?
46 PsiBlast_CBE 84.4431%-105 - C4 -3TYA 4.9 ?
43 PsiBlast_CBE 84.3431%-104 - C4 -3TYB 3.5 ?
23 PsiBlast_CBE 84.0434% -88 - C4 -3TYZ 3.4 ?
9 PsiBlast_PDB 83.9931%-106 - C4 -1TWZ 3.6 ?
41 PsiBlast_CBE 83.8231%-111 - C4 -3TYD 3.6 ?
34 PsiBlast_CBE 83.7431%-110 - C4 -4D9P 3.8 ?
44 PsiBlast_CBE 83.4131%-108 - C4 -3TYB 3.6 ?
15 PsiBlast_PDB 83.2931%-103 - C4 -3H24 3.8 ?
10 PsiBlast_PDB 83.2931%-108 - C4 -1TX0 4.8 ?
42 PsiBlast_CBE 83.1231%-109 - C4 -3TYC 3.8 ?
54 PsiBlast_CBE 83.0331%-110 - C4 -3H24 3.8 ?
48 PsiBlast_CBE 82.5431%-105 - C4 -3H2N 3.4 ?
64 HHSearch 82.4530%-103 - C4 -1EYE 4.0 DHPS1_MYCTU
11 PsiBlast_PDB 82.1131%-103 - C4 -1TX2 3.4 ?
36 PsiBlast_CBE 81.9231%-109 - C4 -4D8Z 4.0 ?
20 PsiBlast_PDB 81.9031%-102 - C4 -3H2M 4.4 ?
8 PsiBlast_PDB 81.7531%-106 - C4 -1TWW 4.2 ?
56 PsiBlast_CBE 81.7231%-110 - C4 -1TX0 4.9 ?
13 PsiBlast_PDB 81.4731%-108 - C4 -3H22 3.6 ?
31 PsiBlast_CBE 81.4431%-107 - C4 -4DB7 3.9 ?
19 PsiBlast_PDB 81.1531%-101 - C4 -3H2F 4.4 ?
12 PsiBlast_PDB 80.8131%-106 - C4 -3H21 3.2 ?
14 PsiBlast_PDB 80.7931%-100 - C4 -3H23 4.1 ?
16 PsiBlast_PDB 80.6831%-106 - C4 -3H26 3.4 ?
55 PsiBlast_CBE 80.5631%-110 - C4 -1TX2 3.3 ?
38 PsiBlast_CBE 80.5131%-108 - C4 -4D8A 4.4 ?
32 PsiBlast_CBE 80.2331%-109 - C4 -4DAI 3.4 ?
33 PsiBlast_CBE 80.1631%-102 - C4 -4DAI 3.8 ?
17 PsiBlast_PDB 80.0431%-112 - C4 -3H2A 3.5 ?
50 PsiBlast_CBE 79.8331%-107 - C4 -3H2M 4.1 ?
37 PsiBlast_CBE 79.1531%-109 - C4 -4D8Z 4.2 ?
35 PsiBlast_CBE 79.0431%-105 - C4 -4D9P 3.9 ?
47 PsiBlast_CBE 76.8431%-102 - C4 -3H2O 4.6 ?