@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1198: (2015-12-21 )
MRYQNMFETLKKHKKMAFIPFVTLGDPNYELSFEIVKTLIISGVSALELGLAFSDPVADGTTIQASHLRALKHASMAKNFQLLKKIRGYNHDIPIGLLAYANLIFSYGVDGFYAQAKECGVDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASSKDLEQVATHSQGYIYTLARSGVTGASHTLENDASAIIKTLKTFSSTPALLGFGISKKEHITNAKGMGADGVICGSALVKIIEENLNNEDAMLEKIKGFVGGMIS

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HPF_A_4(1TJP)
TRPA_SALTY
[Raw transfer]




IGP_A_4(2RH9)
TRPA_SALTY
[Raw transfer]




IGP_A_3(1QOQ)
TRPA_SALTY
[Raw transfer]




IAD_A_4(1K3U)
TRPA_SALTY
[Raw transfer]




IGP_A_3(1KFB)
TRPA_SALTY
[Raw transfer]




HSP_A_5(1CW2)
TRPA_SALTY
[Raw transfer]




F19_A_3(2CLO)
TRPA_SALTY
[Raw transfer]




IGP_A_4(2RHG)
TRPA_SALTY
[Raw transfer]




F19_A_4(2CLH)
TRPA_SALTY
[Raw transfer]




HE1_A_4(1C8V)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1A5S)
TRPA_SALTY
[Raw transfer]




IPL_A_3(1QOP)
TRPA_SALTY
[Raw transfer]




IAG_A_4(1K8Z)
TRPA_SALTY
[Raw transfer]




F9F_A_3(2CLL)
TRPA_SALTY
[Raw transfer]




HE1_A_5(1C29)
TRPA_SALTY
[Raw transfer]




IPL_A_4(1KFC)
TRPA_SALTY
[Raw transfer]




F6F_A_3(2CLM)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HN4)
TRPA_SALTY
[Raw transfer]




F9F_A_4(2CLI)
TRPA_SALTY
[Raw transfer]




FIP_A_5(1A50)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HT3)
TRPA_SALTY
[Raw transfer]




F9F_A_3(3PR2)
TRPA_SALTY
[Raw transfer]




IPL_A_4(2TRS)
TRPA_SALTY
[Raw transfer]




IAV_E_5(1K7F)
TRPA_SALTY
[Raw transfer]




IAG_A_4(1K7E)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1FUY)
TRPA_SALTY
[Raw transfer]




NHP_A_4(1CX9)
TRPA_SALTY
[Raw transfer]




G3P_A_3(2J9X)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HPJ)
TRPA_SALTY
[Raw transfer]




G3P_A_4(2TSY)
TRPA_SALTY
[Raw transfer]




F6F_A_3(2CLF)
TRPA_SALTY
[Raw transfer]




IPL_A_7(1BEU)
TRPA_SALTY
[Raw transfer]




F6F_A_4(2CLE)
TRPA_SALTY
[Raw transfer]




F6F_A_3(4KKX)
TRPA_SALTY
[Raw transfer]




G3P_A_3(1WBJ)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HPX)
TRPA_SALTY
[Raw transfer]




G3H_A_3(2CLK)
TRPA_SALTY
[Raw transfer]




HF1_A_5(1C9D)
TRPA_SALTY
[Raw transfer]




G3P_A_6(3CEP)
TRPA_SALTY
[Raw transfer]




13P_A_4(1K8Y)
TRPA_SALTY
[Raw transfer]




GOL_A_23(1WQ5)
TRPA_ECOLI
[Raw transfer]




IGP_A_7(1A5B)
TRPA_SALTY
[Raw transfer]




EDO_A_3(3NAV)
TRPA_VIBCH
[Raw transfer]




34 PsiBlast_CBE 95.6148%-126 - C2 -2CLH 6.6 TRPA_SALTY
28 PsiBlast_CBE 95.1148%-130 - C2 -2RH9 6.1 TRPA_SALTY
30 PsiBlast_CBE 94.9048%-125 - C2 -2CLO 7.5 TRPA_SALTY
1 PsiBlast_PDB 94.6748%-125 - C2 -1QOP 7.5 TRPA_SALTY
25 PsiBlast_CBE 94.5348%-125 - C2 -4HN4 7.1 TRPA_SALTY
20 PsiBlast_PDB 94.3848%-123 - C2 -1C29 6.2 TRPA_SALTY
46 PsiBlast_CBE 94.3348%-128 - C2 -1KFB 5.8 TRPA_SALTY
42 PsiBlast_CBE 94.1348%-128 - C2 -1K7E 4.7 TRPA_SALTY
45 PsiBlast_CBE 94.0848%-122 - C2 -1C8V 6.7 TRPA_SALTY
33 PsiBlast_CBE 94.0248%-126 - C2 -2CLI 6.1 TRPA_SALTY
7 PsiBlast_PDB 93.9948%-124 - C2 -3PR2 7.3 TRPA_SALTY
37 PsiBlast_CBE 93.8648%-122 - C2 -1TJP 6.3 TRPA_SALTY
4 PsiBlast_PDB 93.7848%-122 - C2 -2CLK 4.4 TRPA_SALTY
3 PsiBlast_PDB 93.7848%-122 - C2 -1WBJ 4.4 TRPA_SALTY
24 PsiBlast_CBE 93.7448%-124 - C2 -4HPJ 7.0 TRPA_SALTY
2 PsiBlast_PDB 93.6248%-129 - C2 -1K8X - TRPA_SALTY -
21 PsiBlast_CBE 93.5448%-119 - C2 -4KKX 6.7 TRPA_SALTY
38 PsiBlast_CBE 93.4848%-127 - C2 -1QOQ 6.0 TRPA_SALTY
29 PsiBlast_CBE 93.3148%-124 - C2 -2J9X 3.9 TRPA_SALTY
17 PsiBlast_PDB 93.3148%-122 - C2 -1C9D 6.5 TRPA_SALTY
6 PsiBlast_PDB 93.2648%-122 - C2 -3CEP 6.7 TRPA_SALTY
47 PsiBlast_CBE 93.2248%-128 - C2 -1KFC 5.3 TRPA_SALTY
41 PsiBlast_CBE 93.2048%-130 - C2 -1K7F 4.6 TRPA_SALTY
40 PsiBlast_CBE 93.1848%-128 - C2 -1K8Y 3.0 TRPA_SALTY
49 PsiBlast_CBE 93.1148%-130 - C2 -1A5B 5.4 TRPA_SALTY
32 PsiBlast_CBE 93.0348%-121 - C2 -2CLL 6.2 TRPA_SALTY
23 PsiBlast_CBE 93.0348%-123 - C2 -4HPX 7.0 TRPA_SALTY
36 PsiBlast_CBE 93.0248%-128 - C2 -2CLE 5.4 TRPA_SALTY
22 PsiBlast_CBE 92.9348%-121 - C2 -4HT3 7.1 TRPA_SALTY
18 PsiBlast_PDB 92.8448%-123 - C2 -1CW2 6.4 TRPA_SALTY
13 PsiBlast_PDB 92.8448%-125 - C2 -1A50 7.2 TRPA_SALTY
44 PsiBlast_CBE 92.6648%-122 - C2 -1FUY 7.2 TRPA_SALTY
31 PsiBlast_CBE 92.6248%-128 - C2 -2CLM 5.6 TRPA_SALTY
19 PsiBlast_PDB 92.5148%-122 - C2 -1CX9 5.6 TRPA_SALTY
43 PsiBlast_CBE 92.4348%-122 - C2 -1K3U 6.7 TRPA_SALTY
14 PsiBlast_PDB 92.3948%-124 - C2 -1A5S 7.0 TRPA_SALTY
27 PsiBlast_CBE 92.3548%-128 - C2 -2RHG 5.8 TRPA_SALTY
39 PsiBlast_CBE 92.2548%-127 - C2 -1K8Z 4.6 TRPA_SALTY
35 PsiBlast_CBE 92.1748%-128 - C2 -2CLF 5.9 TRPA_SALTY
12 PsiBlast_PDB 91.3548%-124 - C2 -2TRS 6.1 TRPA_SALTY
26 PsiBlast_CBE 90.7048%-119 - C2 -2TSY 2.9 TRPA_SALTY
48 PsiBlast_CBE 90.4748%-125 - C2 -1BEU 4.8 TRPA_SALTY
50 PsiBlast_CBE 88.7347%-120 - C2 -3NAV 2.8 TRPA_VIBCH
51 PsiBlast_CBE 88.0147%-125 - C2 -1WQ5 2.9 TRPA_ECOLI