Study : jhp_1200 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C6_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C6_S1
Complex: ACY_B_14(1VC4) / Model_23(1VC4/B) = [3.1] Download433.9621.90MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY
Complex: BE2_A_3(3T44) / Model_14(3T44/A) = [3.2] Download530.2124.58MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY
Complex: 5RG_A_2(3T78) / Model_16(3T78/A) = [3.2] Download374.0921.75MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY
Complex: 4RG_A_2(3T55) / Model_15(3T55/A) = [5.2] Download460.5619.78MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY
Complex: IGP_B_2(1A53) / Model_12(1A53/A) = [6.0] Download539.4816.54MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY
Consensus
[pKd Mean = 4.14]
-467
(s=61)
20
(s=2)
MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY