@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1200: (2015-12-21 )
MPSVLENILKDKLLEVAVLKKNHALPINIAPSDRDFKKALLEKKTSFILEYKKASPSKGLIRKDFDLLEITKTYEKFASCVSVLADSKYFLGSYENIKIVSQHSTKPILCKDFIIDAFQIKLARVMGSNAVLLMLSVLDDKNYLELFNLAKSLNMSVLTEVSNQQEIERLLKLQYDIIGINNRDLHTLKTDIFHTLELRPLLPKDAIIISESGIYSHAQIKALAPCVNGFLVGSSLMKEKDLKKACIKLILGENKVCGLTRIKDAKAVYKNHFIYGGLIFEKSSPRYIKPKEALKITKAVKKLDFVGVFVKDKIKKIAKIAKKLDLKAVQLYGYSQKEIAQLKKSLPKTCAIWQVVSVADSKDLAPKTKEASLILYDTKGDKMGGNGVSFDWEILENAKTPFMLAGGLNLDNIQKALKIKALGLDFNSGLEISPGIKNKDKIKQLARILREY

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

137_B_2(1LBL)
TRPC_SULSO
[Raw transfer]




137_P_8(1JCM)
TRPC_ECOLI
[Raw transfer]




137_B_2(1LBF)
TRPC_SULSO
[Raw transfer]




IGP_A_2(3T44)
TRPC_MYCTU
[Raw transfer]




4RG_A_2(3T55)
TRPC_MYCTU
[Raw transfer]




3RG_A_2(3T40)
TRPC_MYCTU
[Raw transfer]




BE2_A_3(3T44)
TRPC_MYCTU
[Raw transfer]




UNL_B_6(3TSM)
TRPC_BRUA2
[Raw transfer]




MES_B_2(1JUL)
TRPC_SULSO
[Raw transfer]




5RG_A_2(3T78)
TRPC_MYCTU
[Raw transfer]




IGP_B_2(1A53)
TRPC_SULSO
[Raw transfer]




ACY_B_14(1VC4)
?
[Raw transfer]




32 HHSearch 96.1347%-108 - C6 -1PII - TRPC_ECOLI -
1 PsiBlast_PDB 94.7545%-103 - C6 -1PII - TRPC_ECOLI -
2 PsiBlast_PDB 75.8850%-115 - C6 -1JCM 7.4 TRPC_ECOLI
54 Fugue 72.3750%-125 - C6 -1PII - ? -
3 PsiBlast_PDB 69.2037%-115 - C6 -3TSM - TRPC_BRUA2 -
35 HHSearch 69.1637%-111 - C6 -3TSM - TRPC_BRUA2 -
38 HHSearch 69.1233%-112 * C6 *3QJA - TRPC_MYCTU -
6 PsiBlast_PDB 68.2635%-101 - C6 -1VC4 - ? -
23 PsiBlast_CBE 67.8535%-102 - C6 -1VC4 3.1 ?
37 HHSearch 67.6936%-107 - C6 -1VC4 - ? -
36 HHSearch 66.8232%-108 - C6 -1I4N - TRPC_THEMA -
21 PsiBlast_CBE 66.7137%-105 - C6 -3TSM 2.8 TRPC_BRUA2
13 PsiBlast_PDB 65.3733%-106 - C6 -3T40 2.9 TRPC_MYCTU
16 PsiBlast_PDB 64.3633%-100 - C6 -3T78 3.2 TRPC_MYCTU
18 PsiBlast_PDB 64.1732% -99 - C6 -4FB7 - TRPC_MYCTU -
15 PsiBlast_PDB 63.8533%-100 - C6 -3T55 5.2 TRPC_MYCTU
14 PsiBlast_PDB 63.7333% -98 - C6 -3T44 6.4 TRPC_MYCTU
12 PsiBlast_PDB 63.6835%-109 - C6 -1A53 6.0 TRPC_SULSO
26 PsiBlast_CBE 63.2331% -94 - C6 -3UY7 - ? -
27 PsiBlast_CBE 62.8531% -92 - C6 -3UY7 - ? -
9 PsiBlast_PDB 62.4334%-100 - C6 -1JUL 2.0 TRPC_SULSO
10 PsiBlast_PDB 62.4135%-106 - C6 -1LBF 7.8 TRPC_SULSO
11 PsiBlast_PDB 62.2535%-109 - C6 -1LBL 7.2 TRPC_SULSO