@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1335: (2015-12-22 )
MLILSRKVNEGIVIDDNIHIKVISIDRGSVRLGFEAPESTLILRTELKEAIVSENQKASASVDESLLENIKKVIKP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_C_1(2JPP)
?
[Raw transfer]
-
7 PsiBlast_PDB 90.1536%-157 - C5 -4KRW - ? -
15 PsiBlast_CBE 88.1536%-146 - C5 -4KJI - ? -
6 PsiBlast_PDB 82.8736%-142 - C5 -4KJI - ? -
4 PsiBlast_PDB 75.6830%-146 - C- -2BTI - CSRA_PECAS -
3 PsiBlast_PDB 74.0441%-140 - C5 -2JPP - ? -
17 HHSearch 73.0534%-131 - C5 -2JPP 5.0 ?
11 PsiBlast_CBE 71.4641%-141 - C5 -2MFF - ? -
10 PsiBlast_CBE 70.8641%-144 - C5 -2MFG - ? -
9 PsiBlast_CBE 70.8141%-142 - C5 -2MFH - ? -
14 PsiBlast_CBE 69.7241%-123 - C5 -2JPP - ? -
13 PsiBlast_CBE 69.6541%-134 - C5 -2MFC - ? -
12 PsiBlast_CBE 67.7841%-126 - C5 -2MFE - ? -
1 PsiBlast_PDB 67.3145%-102 - C5 -1T3O - CSRA_BACSU -
16 HHSearch 63.8738% -74 - C5 -1T3O - CSRA_BACSU -
37 Fugue 56.7832% -60 - C5 -1Y00 - CSRA_ECOLI -
2 PsiBlast_PDB 56.0733% -59 - C5 -1Y00 - CSRA_ECOLI -
5 PsiBlast_PDB 53.8632% -24 - C5 -1VPZ - CSRA_PSEAE -
39 Fugue 50.5019% -89 - C4 -1XKP - YSCB_YERPE -
18 HHSearch 46.4331% 24 - C5 -1VPZ - CSRA_PSEAE -
33 HHSearch 44.0427%-150 - C5 -3GG8 - ? -