Study : jhp_1368 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: PNS_A_5(3NBK) / Model_117(3NBK/A) = [3.3] Download1647.3626.30MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV
Complex: ADP_B_9(4NAT) / Model_33(4NAT/B) = [3.5] Download1565.750.65MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV
Complex: ACY_A_6(3NV7) / Model_2(3NV7/A) = [3.5] Download640.8512.09MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV
Complex: ACY_A_6(3NV7) / Model_114(3NV7/A) = [3.5] Download548.9612.09MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV
Complex: PNS_B_8(1H1T) / Model_26(1H1T/B) = [3.5] Download913.4525.57MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV
Consensus
[pKd Mean = 3.46]
-1063
(s=460)
15
(s=9)
MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATKSFKNVECVAFEGLLADLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMPTLQNAFISSSIVRSIIAHKGDASHLVPKEIYPFISKV