@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : jhp_1421: (2015-12-23 )
MEVICKHYTPLDIASQAIRTCWQSFEYSDDGGCKDRDLIHRVGNIFRHSSTLEHLYYNFEIKGLSRGALQELSRHRIASLSVKSSRYTLRELKEVESFLPLNETNLERAKEFLVFVDDEKVNEMSVLALENLRVLLSEHNIKNDLAKYAMPESYKTHLAYSINARSLQNLLTLRSSNKALKEMQDLAKALFDALPYEHQYLFEDCLKH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_D_13(3N3Y)
?
[Raw transfer]




FAD_D_13(3N3Y)
?
[Raw transfer]




FAD_C_11(3N3Y)
?
[Raw transfer]




FAD_C_11(3N3Y)
?
[Raw transfer]




FAD_D_13(3N3Y)
?
[Raw transfer]




2 PsiBlast_PDB 98.5796%-101 - C5 -3AH5 - THYX_HELPY -
22 PsiBlast_CBE 98.4997%-106 - C5 -3N3Y 2.5 ?
21 PsiBlast_CBE 98.4097%-100 - C5 -3N3Y 7.8 ?
1 PsiBlast_PDB 98.2797%-105 - C5 -3N3Y 6.8 ?
28 PsiBlast_CBE 98.1796%-108 - C5 -3AH5 - THYX_HELPY -
25 PsiBlast_CBE 97.7296%-105 - C5 -3AH5 - THYX_HELPY -
27 PsiBlast_CBE 97.4996%-105 - C5 -3AH5 - THYX_HELPY -
29 HHSearch 96.6495%-104 - C5 -3N3Y 6.8 ?
23 PsiBlast_CBE 96.1697%-107 - C5 -3N3Y 6.4 ?
26 PsiBlast_CBE 95.9196%-101 - C5 -3AH5 - THYX_HELPY -
24 PsiBlast_CBE 95.7696%-105 - C5 -3AH5 - THYX_HELPY -
19 PsiBlast_PDB 64.5228% -71 - C5 -4GTD - THYX_THEMA -
3 PsiBlast_PDB 64.3028% -71 - C5 -1O24 - THYX_THEMA -
18 PsiBlast_PDB 64.2628% -63 - C5 -4GTC - THYX_THEMA -
20 PsiBlast_PDB 63.5528% -68 - C5 -4GTE - THYX_THEMA -
30 HHSearch 63.1824% -63 * C5 *3GWC - THYX_MYCTU -
31 HHSearch 62.5522% -70 - C5 -3FNN - THYX_CORGL -
13 PsiBlast_PDB 62.3128% -66 - C5 -4GTB - THYX_THEMA -
16 PsiBlast_PDB 62.2128% -61 - C5 -3G4A - THYX_THEMA -
10 PsiBlast_PDB 61.8728% -62 - C5 -1O2B - THYX_THEMA -