@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0001: (2016-03-11 )
VQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISAPNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGIEIGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAVGHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKEGTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEALKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDASLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_8(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_C_9(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_A_7(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_A_3(2Z4S)
DNAA_THEMA
[Raw transfer]




ADP_A_3(2Z4S)
DNAA_THEMA
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




42 HHSearch 87.0439% -91 - C2 -1L8Q 7.9 DNAA_AQUAE
31 Fugue 86.2538% -92 - C2 -1L8Q 7.9 DNAA_AQUAE
5 PsiBlast_PDB 85.0238% -89 - C2 -1L8Q 7.9 DNAA_AQUAE
23 PsiBlast_CBE 84.6038% -88 - C2 -3R8F - DNAA_AQUAE -
24 PsiBlast_CBE 84.4538% -87 - C2 -3R8F - DNAA_AQUAE -
25 PsiBlast_CBE 84.0138% -86 - C2 -3R8F - DNAA_AQUAE -
3 PsiBlast_PDB 83.6338% -87 - C2 -3R8F - DNAA_AQUAE -
26 PsiBlast_CBE 83.3038% -86 - C2 -2HCB - DNAA_AQUAE -
4 PsiBlast_PDB 82.4638% -87 - C2 -2HCB - DNAA_AQUAE -
22 PsiBlast_CBE 82.3737%-102 - C2 -2Z4R 7.5 DNAA_THEMA
27 PsiBlast_CBE 82.2638% -84 - C2 -2HCB - DNAA_AQUAE -
1 PsiBlast_PDB 82.1537%-102 - C2 -2Z4R 6.7 DNAA_THEMA
21 PsiBlast_CBE 82.0537%-102 - C2 -2Z4R 7.2 DNAA_THEMA
2 PsiBlast_PDB 81.5037%-103 - C2 -2Z4S 7.3 DNAA_THEMA
41 HHSearch 81.1937%-105 - C2 -2Z4S 7.3 DNAA_THEMA
28 PsiBlast_CBE 80.7838% -82 - C2 -2HCB - DNAA_AQUAE -
11 PsiBlast_PDB 55.6224% -76 - C2 -3BOS - ? -
10 PsiBlast_PDB 54.5624% -75 - C2 -3SC3 - ? -
61 HHSearch 52.5621% -86 - C2 -3PFI - ? -
7 PsiBlast_PDB 52.0048% -98 - C1 -4TPS - DNAA_BACSU -