Study : Lmo0010 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 3 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: DP6_A_3(2OI2) / Model_1(2OI2/A) = [4.4] Download804.5310.93LATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTKFSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIMHFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQEIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN
Complex: DP6_A_3(2OI2) / Model_61(2OI2/A) = [4.4] Download828.6210.93LATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTKFSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIMHFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQEIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN
Complex: DP6_A_3(2OI2) / Model_40(2OI2/A) = [4.4] Download831.1610.93LATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTKFSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIMHFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQEIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN
Consensus
[pKd Mean = 4.40]
-821
(s=12)
10
(s=0)
LATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTKFSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVATSIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIMHFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDADTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQEIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN