@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0018: (2016-03-11 )
MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPSKALATDYGFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVFDECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTFNEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLAAGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDALRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITMNTIYDRYQKPLFIVENGLGAVDTVEEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYTPWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P53_A_2(4F79)
?
[Raw transfer]




6GB_A_3(4GPN)
?
[Raw transfer]




BG6_A_3(4F66)
?
[Raw transfer]




1FT_B_3(4IPN)
?
[Raw transfer]




BG6_B_7(4F66)
?
[Raw transfer]




6GB_B_5(4GPN)
?
[Raw transfer]




BGP_B_4(4PBG)
LACG_LACLL
[Raw transfer]




BGP_A_3(4PBG)
LACG_LACLL
[Raw transfer]




GOL_A_3(4IPL)
?
[Raw transfer]




1FT_E_4(4IPN)
?
[Raw transfer]




BGC_A_2(3QOM)
?
[Raw transfer]




21 PsiBlast_CBE 96.9456% -83 - C2 -4IPN 2.7 ?
2 PsiBlast_PDB 96.2256% -84 - C2 -4IPN 3.6 ?
1 PsiBlast_PDB 95.5456% -82 - C2 -4IPL 2.6 ?
23 PsiBlast_CBE 94.4455% -81 - C2 -2XHY - BGLA_ECOLI -
22 PsiBlast_CBE 94.2055% -83 - C2 -2XHY - BGLA_ECOLI -
25 PsiBlast_CBE 93.8854% -73 - C2 -4F66 5.1 ?
7 PsiBlast_PDB 93.8853% -74 - C2 -3PN8 - ? -
4 PsiBlast_PDB 93.5554% -72 - C2 -4F66 5.7 ?
104 HHSearch 93.3756% -78 - C2 -2XHY - BGLA_ECOLI -
5 PsiBlast_PDB 93.0554% -75 - C2 -4F79 5.6 ?
3 PsiBlast_PDB 92.9255% -80 - C2 -2XHY - BGLA_ECOLI -
24 PsiBlast_CBE 92.4255% -82 - C2 -2XHY - BGLA_ECOLI -
6 PsiBlast_PDB 92.3554% -73 - C2 -4GPN 4.1 ?
26 PsiBlast_CBE 92.2654% -75 - C2 -4GPN 6.3 ?
8 PsiBlast_PDB 88.7152% -77 - C2 -3QOM 2.7 ?
9 PsiBlast_PDB 88.1352% -76 - C2 -4GZE - ? -
93 Fugue 78.5733% -83 - C2 -1E4I - BGLA_PAEPO -
91 PsiBlast_CBE 77.5033% -74 - C2 -4PBG 4.9 LACG_LACLL
89 PsiBlast_CBE 77.3634% -74 - C2 -2PBG - LACG_LACLL -
86 PsiBlast_CBE 77.3334% -71 - C2 -3PBG - LACG_LACLL -
90 PsiBlast_CBE 76.7933% -74 - C2 -4PBG 4.8 LACG_LACLL