@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0039: (2016-03-11 )
MNQKIVVALGGNAILSSDASAEAQRSALEETAEYLVQFIENGDDLIISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKHGLDKVAVSLITQVVVDKDDPAFEKPTKPIGPFLNKEEAEKEMAETGAIFLEDAGRGYRKVVPSPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKLAELIDADLLVILTGVENVYINYNQPNQKKLEQVTVSELEKYIDEKQFAAGSMLPKIEAATAFVKERPHAKAIITSLENIGAMLERGAGTVIVAG

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_C_9(2WE5)
ARCC1_ENTFA
[Raw transfer]




ADP_A_4(2WE5)
ARCC1_ENTFA
[Raw transfer]




ANP_A_5(4JZ7)
?
[Raw transfer]




ADP_A_4(2WE5)
ARCC1_ENTFA
[Raw transfer]




ADP_B_7(2WE5)
ARCC1_ENTFA
[Raw transfer]




ANP_D_8(4JZ7)
?
[Raw transfer]




ADP_B_5(1E19)
CPKA_PYRFU
[Raw transfer]




ANP_C_7(4JZ7)
?
[Raw transfer]




ANP_B_6(4JZ7)
?
[Raw transfer]




ADP_A_3(1E19)
CPKA_PYRFU
[Raw transfer]




ADP_A_3(1E19)
CPKA_PYRFU
[Raw transfer]




GOL_C_7(3KZF)
?
[Raw transfer]




GOL_B_5(3KZF)
?
[Raw transfer]




GOL_D_6(3KZF)
?
[Raw transfer]




CIT_D_8(4JZ8)
?
[Raw transfer]




CIT_B_6(4JZ8)
?
[Raw transfer]




CIT_B_8(4OLC)
?
[Raw transfer]




CIT_A_5(4JZ8)
?
[Raw transfer]




CIT_B_6(4JZ9)
?
[Raw transfer]




CIT_C_7(4JZ8)
?
[Raw transfer]




CIT_A_5(4OLC)
?
[Raw transfer]




CIT_A_5(4JZ9)
?
[Raw transfer]




CIT_D_8(4JZ9)
?
[Raw transfer]




CIT_D_11(4OLC)
?
[Raw transfer]




CIT_C_9(4OLC)
?
[Raw transfer]




CIT_C_7(4JZ9)
?
[Raw transfer]




54 Fugue 95.9663% -84 - C3 -1B7B - ARCC1_ENTFC -
1 PsiBlast_PDB 95.5764% -90 - C3 -1B7B - ARCC1_ENTFC -
27 PsiBlast_CBE 95.5064% -89 - C3 -1B7B - ARCC1_ENTFC -
53 Fugue 95.3862% -88 - C3 -1B7B - ARCC1_ENTFC -
24 PsiBlast_CBE 95.3864% -89 - C3 -2WE4 - ARCC1_ENTFA -
21 PsiBlast_CBE 95.0164% -89 - C3 -2WE5 7.0 ARCC1_ENTFA
26 PsiBlast_CBE 94.9864% -89 - C3 -1B7B - ARCC1_ENTFC -
28 PsiBlast_CBE 94.5764% -88 - C3 -1B7B - ARCC1_ENTFC -
25 PsiBlast_CBE 94.4364% -84 - C3 -2WE4 - ARCC1_ENTFA -
2 PsiBlast_PDB 94.0364% -86 - C3 -2WE4 - ARCC1_ENTFA -
3 PsiBlast_PDB 93.6964% -88 - C3 -2WE5 7.2 ARCC1_ENTFA
23 PsiBlast_CBE 93.0264% -86 - C3 -2WE4 - ARCC1_ENTFA -
22 PsiBlast_CBE 92.6764% -90 - C3 -2WE5 7.2 ARCC1_ENTFA
29 PsiBlast_CBE 90.1345% -84 - C3 -1E19 7.0 CPKA_PYRFU
35 PsiBlast_CBE 89.5042% -85 - C3 -4JZ9 3.2 ?
63 HHSearch 89.1255% -93 - C3 -2WE5 7.2 ARCC1_ENTFA
7 PsiBlast_PDB 88.9042% -89 - C3 -4JZ9 3.1 ?
4 PsiBlast_PDB 88.7945% -80 - C3 -1E19 6.8 CPKA_PYRFU
33 PsiBlast_CBE 88.7642% -89 - C3 -4JZ9 3.3 ?
38 PsiBlast_CBE 88.6242% -90 - C3 -4JZ8 4.0 ?
34 PsiBlast_CBE 88.5842% -91 - C3 -4JZ9 3.6 ?
39 PsiBlast_CBE 88.4242% -95 - C3 -4JZ7 6.0 ?
6 PsiBlast_PDB 88.4042% -87 - C3 -4JZ8 2.7 ?
37 PsiBlast_CBE 88.3942% -91 - C3 -4JZ8 3.3 ?
40 PsiBlast_CBE 88.2342% -95 - C3 -4JZ7 6.0 ?
36 PsiBlast_CBE 87.2942% -85 - C3 -4JZ8 3.5 ?
32 PsiBlast_CBE 87.2942% -88 - C3 -4OLC 3.0 ?
31 PsiBlast_CBE 86.8742% -92 - C3 -4OLC 3.6 ?
8 PsiBlast_PDB 86.0942% -87 - C3 -4OLC 3.0 ?
30 PsiBlast_CBE 86.0642% -89 - C3 -4OLC 2.9 ?
62 HHSearch 85.2843% -83 * C3 *1E19 4.6 CPKA_PYRFU
5 PsiBlast_PDB 84.7042%-105 - C3 -4JZ7 6.5 ?
43 PsiBlast_CBE 84.4642% -89 - C3 -3KZF 2.8 ?
44 PsiBlast_CBE 84.3042% -88 - C3 -3KZF 3.0 ?
42 PsiBlast_CBE 82.9942% -91 - C3 -3KZF 2.1 ?
41 PsiBlast_CBE 82.9542% -96 - C3 -4JZ7 6.4 ?