@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0055: (2016-03-11 )
MSSVVVVGTQWGDEGKGKITDFLSENAEAIARYQGGNNAGHTIKFDGVTYKLHLIPSGIFYKEKISVIGNGMVVDPKALVEELKYLHDKGVDTSNLRISNRAHIILPYHIRIDEADEERKGANKIGTTKKGIGPAYMDKAARVGIRIIDLLDKETFKEKLEHNLGEKNRLLERFYELEGFKLEDILDEYYEYGQQFKEYVCDTSVVLNDALDDGKRVLFEGAQGVMLDIDQGTYPFVTSSNPIAGGVTIGSGVGPSKINHVVGVAKAYTTRVGDGPFPTELFDSIGDTIREVGHEYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLTLLDVLTGIETLKICVAYKLDGKTITEFPASLKDLARCEPVYEELPGWTEDITGVTSLDDLPVNCRHYMERIAQLTGVQVSMFSVGPDRAQTHVIKSVWRLA

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RPD_A_5(1QF4)
PURA_ECOLI
[Raw transfer]




DOI_A_3(2DGN)
PURA1_MOUSE
[Raw transfer]




2SA_A_5(1MEZ)
PURA1_MOUSE
[Raw transfer]




DOI_A_3(2GCQ)
PURA_ECOLI
[Raw transfer]




RPL_A_5(1QF5)
PURA_ECOLI
[Raw transfer]




RPL_A_5(1QF5)
PURA_ECOLI
[Raw transfer]




IMP_C_3(1KJX)
PURA_ECOLI
[Raw transfer]




AMP_A_3(4M9D)
PURA_BACAN
[Raw transfer]




IMP_A_8(1IWE)
PURA1_MOUSE
[Raw transfer]




IMP_A_5(1KKF)
PURA_ECOLI
[Raw transfer]




IMP_E_5(1KKB)
PURA_ECOLI
[Raw transfer]




AMP_E_5(1MF1)
PURA1_MOUSE
[Raw transfer]




AMP_C_3(1SON)
PURA_ECOLI
[Raw transfer]




H5P_A_6(1SOO)
PURA_ECOLI
[Raw transfer]




GDP_A_4(1CIB)
PURA_ECOLI
[Raw transfer]




GDP_A_4(2GCQ)
PURA_ECOLI
[Raw transfer]




GDP_A_5(1CG0)
PURA_ECOLI
[Raw transfer]




GDP_A_4(1CG4)
PURA_ECOLI
[Raw transfer]




GDP_A_5(1MF0)
PURA1_MOUSE
[Raw transfer]




GDP_A_5(1LON)
PURA1_MOUSE
[Raw transfer]




GDP_A_6(1P9B)
PURA_PLAFA
[Raw transfer]




GDP_A_6(1P9B)
PURA_PLAFA
[Raw transfer]




GPX_A_4(1CH8)
PURA_ECOLI
[Raw transfer]




GDP_A_5(1CG1)
PURA_ECOLI
[Raw transfer]




GDP_A_6(1LNY)
PURA1_MOUSE
[Raw transfer]




DPO_A_3(1KKF)
PURA_ECOLI
[Raw transfer]




GDP_C_3(1DJ3)
PURA_WHEAT
[Raw transfer]




GDP_D_4(1DJ3)
PURA_WHEAT
[Raw transfer]




GDP_A_4(2DGN)
PURA1_MOUSE
[Raw transfer]




GDP_D_4(1DJ2)
PURA_ARATH
[Raw transfer]




GTP_C_3(1LOO)
PURA1_MOUSE
[Raw transfer]




GDP_A_5(1CG3)
PURA_ECOLI
[Raw transfer]




GDP_B_7(1LNY)
PURA1_MOUSE
[Raw transfer]




GDP_C_3(1DJ2)
PURA_ARATH
[Raw transfer]




GDP_C_3(1DJ2)
PURA_ARATH
[Raw transfer]




GCP_B_4(1HOP)
PURA_ECOLI
[Raw transfer]




GDP_A_2(2V40)
PURA2_HUMAN
[Raw transfer]




GDP_A_2(2V40)
PURA2_HUMAN
[Raw transfer]




HAD_C_3(1KKB)
PURA_ECOLI
[Raw transfer]




IMP_B_7(1IWE)
PURA1_MOUSE
[Raw transfer]




CIT_A_2(3R7T)
PURA_CAMJE
[Raw transfer]




2 PsiBlast_PDB 99.3677% -82 - C3 -4M9D 6.6 PURA_BACAN
1 PsiBlast_PDB 97.3577% -90 - C3 -4M0G - PURA_BACAN -
49 Fugue 89.4548% -78 - C3 -1ADE - PURA_ECOLI -
14 PsiBlast_PDB 89.0948% -77 - C3 -1ADE - PURA_ECOLI -
13 PsiBlast_PDB 88.8148% -73 - C3 -1SOO 5.2 PURA_ECOLI
5 PsiBlast_PDB 88.6348% -68 - C3 -1KKF 7.1 PURA_ECOLI
12 PsiBlast_PDB 88.3548% -71 - C3 -1SON 5.4 PURA_ECOLI
16 PsiBlast_PDB 88.2548% -70 - C3 -1CG1 6.2 PURA_ECOLI
6 PsiBlast_PDB 88.2148% -70 - C3 -1CG0 6.0 PURA_ECOLI
8 PsiBlast_PDB 88.2048% -73 - C3 -1QF4 7.4 PURA_ECOLI
7 PsiBlast_PDB 88.1648% -68 - C3 -1CH8 6.5 PURA_ECOLI
40 HHSearch 88.0247% -77 - C3 -3HID - PURA_YERPE -
18 PsiBlast_PDB 88.0148% -70 - C3 -1CG4 6.0 PURA_ECOLI
10 PsiBlast_PDB 87.9948% -71 - C3 -1CIB 5.8 PURA_ECOLI
11 PsiBlast_PDB 87.9648% -70 - C3 -2GCQ 8.5 PURA_ECOLI
50 Fugue 87.9048% -74 * C3 *1QF5 6.8 PURA_ECOLI
4 PsiBlast_PDB 87.7948% -69 - C3 -1KKB 6.6 PURA_ECOLI
9 PsiBlast_PDB 87.7648% -72 - C3 -1QF5 6.8 PURA_ECOLI
3 PsiBlast_PDB 87.4648% -69 - C3 -1KJX 5.5 PURA_ECOLI
17 PsiBlast_PDB 87.4548% -71 - C3 -1CG3 7.2 PURA_ECOLI
21 PsiBlast_CBE 87.1148% -77 - C3 -1HOP 5.9 PURA_ECOLI
31 PsiBlast_CBE 86.2045% -79 - C3 -1LOO 4.8 PURA1_MOUSE
37 PsiBlast_CBE 85.9042% -75 - C3 -1P9B 5.4 PURA_PLAFA
35 PsiBlast_CBE 85.8545% -76 - C3 -1IWE 5.2 PURA1_MOUSE
44 HHSearch 85.5943% -67 - C3 -1P9B 5.4 PURA_PLAFA
27 PsiBlast_CBE 85.4845% -75 - C3 -2DGN 7.8 PURA1_MOUSE
33 PsiBlast_CBE 85.3045% -74 - C3 -1LNY 4.5 PURA1_MOUSE
32 PsiBlast_CBE 85.2445% -73 - C3 -1LON 5.6 PURA1_MOUSE
34 PsiBlast_CBE 85.1445% -72 - C3 -1LNY 5.3 PURA1_MOUSE
30 PsiBlast_CBE 85.0245% -74 - C3 -1MEZ 7.1 PURA1_MOUSE
29 PsiBlast_CBE 84.9745% -72 - C3 -1MF0 5.7 PURA1_MOUSE
36 PsiBlast_CBE 84.5345% -72 - C3 -1IWE 6.2 PURA1_MOUSE
28 PsiBlast_CBE 84.4345% -74 - C3 -1MF1 5.6 PURA1_MOUSE
39 HHSearch 84.0042% -85 - C3 -2V40 4.7 PURA2_HUMAN
38 PsiBlast_CBE 82.6742% -83 - C3 -2V40 4.7 PURA2_HUMAN
42 HHSearch 82.4244% -72 - C3 -1DJ2 5.0 PURA_ARATH
20 PsiBlast_PDB 82.0544% -70 - C3 -1DJ3 5.7 PURA_WHEAT
25 PsiBlast_CBE 81.9944% -72 - C3 -1DJ2 5.1 PURA_ARATH
43 HHSearch 81.8045% -81 - C3 -3R7T 3.3 PURA_CAMJE
24 PsiBlast_CBE 81.6644% -69 - C3 -1DJ3 5.9 PURA_WHEAT
26 PsiBlast_CBE 81.5444% -73 - C3 -1DJ2 5.0 PURA_ARATH