@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0078: (2016-03-12 )
MTASVFVAGKLLPETMEALSKWDVKAFSGEENITEAELINNVTEVDAIICPLSSPISAKVLESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILDVARRISEGDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVAKRAAAFGMNIIYSGHQPKEAAKEWNAEFVSQKELLKRSDVVTIHAAYSPSLKHLLNETTLKTMKSSAFLINAARGPVVEEAALIKALETGVIAGAALDVFEFEPKIGEDFAKLDNVVLTPHIGNATVETRAAMGKIAIANVEAVLAGKAPLHSVY

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_B_8(2DBZ)
GYAR_PYRHO
[Raw transfer]




NAP_A_7(2DBZ)
GYAR_PYRHO
[Raw transfer]




NDP_K_11(2GCG)
GRHPR_HUMAN
[Raw transfer]




NDP_L_12(2GCG)
GRHPR_HUMAN
[Raw transfer]




NDP_J_10(2GCG)
GRHPR_HUMAN
[Raw transfer]




NAP_A_4(2DBQ)
GYAR_PYRHO
[Raw transfer]




NAP_A_4(2DBQ)
GYAR_PYRHO
[Raw transfer]




NDP_J_10(2GCG)
GRHPR_HUMAN
[Raw transfer]




NAD_D_4(1WWK)
?
[Raw transfer]




NAD_C_3(1WWK)
?
[Raw transfer]




NAI_A_2(4U6Q)
CTBP1_HUMAN
[Raw transfer]




NAP_A_2(3BAZ)
HPPR_PLESU
[Raw transfer]




NAD_A_2(4U6S)
CTBP1_HUMAN
[Raw transfer]




NAD_C_3(1WWK)
?
[Raw transfer]




NAD_E_5(2HU2)
CTBP1_RAT
[Raw transfer]




NAD_A_2(1HKU)
CTBP1_RAT
[Raw transfer]




NAD_A_3(1HL3)
CTBP1_RAT
[Raw transfer]




NAD_A_2(4LCE)
CTBP1_HUMAN
[Raw transfer]




NAD_B_2(1MX3)
CTBP1_HUMAN
[Raw transfer]




NAD_B_2(1MX3)
CTBP1_HUMAN
[Raw transfer]




NAD_B_2(1MX3)
CTBP1_HUMAN
[Raw transfer]




GOL_A_5(2DBQ)
GYAR_PYRHO
[Raw transfer]




FMT_A_4(1HKU)
CTBP1_RAT
[Raw transfer]




FMT_A_2(3GA0)
CTBP1_RAT
[Raw transfer]




FMT_A_3(3GA0)
CTBP1_RAT
[Raw transfer]




NHE_E_5(2CUK)
?
[Raw transfer]




3CR_A_3(4U6Q)
CTBP1_HUMAN
[Raw transfer]




KMT_A_3(4LCE)
CTBP1_HUMAN
[Raw transfer]




ACY_C_3(1MX3)
CTBP1_HUMAN
[Raw transfer]




1 PsiBlast_PDB 96.6846%-115 * C1 *2DBR - GYAR_PYRHO -
26 PsiBlast_CBE 95.3846%-113 - C1 -2DBR - GYAR_PYRHO -
22 PsiBlast_CBE 95.2646%-110 - C1 -2DBR - GYAR_PYRHO -
2 PsiBlast_PDB 94.9246%-113 - C1 -2DBZ 8.5 GYAR_PYRHO
25 PsiBlast_CBE 94.8746%-112 - C1 -2DBR - GYAR_PYRHO -
24 PsiBlast_CBE 94.7646%-114 - C1 -2DBR - GYAR_PYRHO -
21 PsiBlast_CBE 94.6746%-113 - C1 -2DBZ 8.3 GYAR_PYRHO
23 PsiBlast_CBE 94.2046%-111 - C1 -2DBR - GYAR_PYRHO -
112 HHSearch 93.5946%-109 - C1 -2DBQ 10.1 GYAR_PYRHO
7 PsiBlast_PDB 92.1436%-119 - C1 -2GCG 7.6 GRHPR_HUMAN
4 PsiBlast_PDB 92.1047%-124 - C1 -1WWK 7.8 ?
31 PsiBlast_CBE 91.1836%-117 - C1 -2GCG 7.3 GRHPR_HUMAN
32 PsiBlast_CBE 91.0236%-118 - C1 -2GCG 8.2 GRHPR_HUMAN
27 PsiBlast_CBE 90.4147%-125 - C1 -1WWK 8.3 ?
124 HHSearch 90.3743%-123 - C1 -2CUK - ? -
28 PsiBlast_CBE 90.3336%-122 - C1 -2WWR - GRHPR_HUMAN -
8 PsiBlast_PDB 89.6136%-120 - C1 -2WWR - GRHPR_HUMAN -
122 HHSearch 88.9847%-117 - C1 -1WWK 7.6 ?
29 PsiBlast_CBE 88.9336%-118 - C1 -2WWR - GRHPR_HUMAN -
30 PsiBlast_CBE 88.8036%-112 - C1 -2GCG - GRHPR_HUMAN -
3 PsiBlast_PDB 88.3446%-103 - C1 -2DBQ 9.8 GYAR_PYRHO
116 HHSearch 87.7035%-111 - C1 -2GCG 7.4 GRHPR_HUMAN
35 PsiBlast_CBE 84.2744%-110 - C1 -2CUK 2.8 ?
128 HHSearch 76.2834% -99 - C1 -1MX3 6.1 CTBP1_HUMAN
104 Fugue 74.4333% -91 - C1 -1MX3 6.4 CTBP1_HUMAN
20 PsiBlast_PDB 73.9140% -97 - C1 -1MX3 6.8 CTBP1_HUMAN
6 PsiBlast_PDB 73.4941%-101 - C1 -3BAZ 8.7 HPPR_PLESU
45 PsiBlast_CBE 73.2840%-103 - C1 -3GA0 3.3 CTBP1_RAT
40 PsiBlast_CBE 73.0740% -97 - C1 -4U6Q 9.7 CTBP1_HUMAN
39 PsiBlast_CBE 73.0240% -94 - C1 -4U6S 9.7 CTBP1_HUMAN
41 PsiBlast_CBE 72.4940% -95 - C1 -4LCE 9.9 CTBP1_HUMAN
42 PsiBlast_CBE 72.3340% -98 - C1 -2HU2 5.5 CTBP1_RAT
44 PsiBlast_CBE 71.9740% -94 - C1 -1HKU 6.4 CTBP1_RAT
43 PsiBlast_CBE 71.3840% -98 - C1 -1HL3 6.7 CTBP1_RAT