@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0105: (2016-03-12 )
MKKLFSITSVVLLVLSLVVVSIGAEPKRAKAAENVPQYRNVMYYGDWSIWGGEGNFYPKDIPADQLTHLNFAFLDFNSNGDLVFTDKDAAVGAPVGQEGVQWGGANAGVLNAIQDLRAQNPNLKIGVSVGGWSKSGDFSTVAADPTKRANFVKNVMKFVKYTNMDFVDLDWEYPASVRDADLVDNKNDEGTPNAKPADKQNFITLLQDLRTALDKQGVDINKKYELSVALPAAKSTLENGIDVANLFKVVDFANVMTYDLNGAWTPNSAHHTALYGNPKDPNYDSGFSVDQTVKYLKEKGAVSNKIVVGAAFYTRGWNKVAAGTDTALPGLFQAAEKTNKDADGSLTYGANNENPIKTGDGGRAGGVWAYRSIDALKAKTPTLKEYWDDTAKAPYLYSKETGEFYTYDNTRSIGYKAQYVKDNNLGGMISWMQSQDKTTTSTKRDELTKAIKTGLFGTSAIPQNAITYANLNVVATVKPYSENGVGYEITITNNEKADETNEVLKSTELSFETVKLPKFYIPVKAGETLTAGDYKAGTVTTSGGNTVVDLASVYDAQQIPQGASYTFRLKSSASSVDVANISKIDLTQRMVKSSVEFGKQTIFGGGTVVPDPSDTEAPTVPKALASSNVTDKSATLTWTASTDNKAVAGYKVYRNGTEVGSVSGTTFTDSGLTAKTAYTYTVKAYDAAGNFSAASSALTVTTLDAATPPATPAWDAAKTYNKGDRVSYKGKTYEAQWWTQGNEPGAEQWGPWLLIN

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMI_A_4(1OGG)
CHIB_SERMA
[Raw transfer]




ALJ_A_23(1W1V)
?
[Raw transfer]




GOL_A_8(1GOI)
CHIB_SERMA
[Raw transfer]




NGO_A_7(1E6Z)
?
[Raw transfer]




GOL_A_3(1KFW)
?
[Raw transfer]




TYP_A_11(1W1Y)
?
[Raw transfer]




CHQ_A_16(1W1T)
?
[Raw transfer]




0HZ_A_3(1O6I)
CHIB_SERMA
[Raw transfer]




CFF_A_2(3G6M)
?
[Raw transfer]




GOL_A_18(1W1P)
?
[Raw transfer]




GOL_A_9(1ITX)
CHIA1_BACCI
[Raw transfer]




EDO_A_6(3ALF)
?
[Raw transfer]




GOL_A_12(1OGB)
CHIB_SERMA
[Raw transfer]




SUGAR_A_3(1OGG)
CHIB_SERMA
[Raw transfer]

-

CFF_A_3(3G6M)
?
[Raw transfer]




TYP_A_12(1W1Y)
?
[Raw transfer]




CHQ_A_17(1W1T)
?
[Raw transfer]




24 HHSearch 85.9131% -49 - C1 -1GOI 3.5 CHIB_SERMA
32 HHSearch 85.1130% -56 - C1 -1VF8 - CHIL3_MOUSE -
31 HHSearch 85.0131% -58 - C1 -1LL7 - CHI1_COCPS -
33 HHSearch 84.8729% -56 - C1 -3G6M 5.2 ?
27 HHSearch 84.1830% -56 - C1 -1W9P - CHIB1_ASPFM -
22 HHSearch 83.6128% -54 - C1 -3W4R - ? -
48 Fugue 83.0229% -36 - C1 -3OA5 - ? -
42 Fugue 82.9530% -54 - C1 -1E9L - CHIL3_MOUSE -
29 HHSearch 82.6130% -59 * C1 *3FY1 - CHIA_HUMAN -
1 PsiBlast_PDB 82.5532% -45 - C1 -1ITX 2.5 CHIA1_BACCI
23 HHSearch 80.8829% -50 - C1 -1EDQ - ? -
21 HHSearch 79.8729% -43 - C1 -3ARX - ? -
17 PsiBlast_PDB 79.1129% -47 - C1 -1GOI - CHIB_SERMA -
5 PsiBlast_PDB 78.9729% -48 - C1 -1UR8 - ? -
15 PsiBlast_PDB 78.6729% -48 - C1 -1H0I - CHIB_SERMA -
3 PsiBlast_PDB 78.5429% -48 - C1 -1E6R - ? -
16 PsiBlast_PDB 78.3029% -49 - C1 -1UR9 - ? -
26 HHSearch 78.0227% -66 - C- -1WB0 - CHIT1_HUMAN -
2 PsiBlast_PDB 77.9329% -47 - C1 -1E15 - ? -
6 PsiBlast_PDB 77.7729% -45 - C1 -1W1P 2.9 ?
25 HHSearch 75.4330% -45 - C1 -1KFW 2.0 ?