@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0110: (2016-03-12 )
MDYEKALAFIKSNSTLEQEEGTEVIFKQAQETARGNLDPFLLKDLKQHLGGTNDAIKEAPQEIQMPDFSNLEIATAAALQMRATMGSPNIDLSNGVTTEYRVVEGDYGDIPVRIYRHEEATKPVPAFIFYHGGGFVGGTPAVVENFCKGIAEKLPAVVINVDYHLAPEFPAPAAPKDCYRVLEWVVEQSNELGIDASKIGVSGDSAGGTLAAAVSYMDYEAETNYVGFQALLYPALTLVDEDNDKYQWDISKFGASEDTLPLVAPGIIGMNSSGELLRKAYVRDENPAAPIYSPLSAVDKSIYPPTLIASAEFDALRAFADVFAKELRASGVQTKAIVYQGMCHAFIDKYGIFPQAEDVADEIVQMMKEIF

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DEP_A_5(3AIL)
?
[Raw transfer]




EPE_A_2(1EVQ)
?
[Raw transfer]




MPD_A_5(3AIK)
?
[Raw transfer]




MPD_A_5(3AIM)
?
[Raw transfer]




HDS_A_2(1QZ3)
?
[Raw transfer]




23 PsiBlast_CBE 86.7636%-104 - C1 -1JJI - ? -
45 HHSearch 85.8236%-103 - C1 -1JJI - ? -
1 PsiBlast_PDB 85.0036%-105 - C1 -1JJI - ? -
21 PsiBlast_CBE 84.6236%-105 - C1 -1JJI - ? -
41 HHSearch 84.1630% -87 - C1 -3QH4 - ? -
22 PsiBlast_CBE 83.5636%-103 - C1 -1JJI - ? -
37 Fugue 82.6327% -89 - C1 -4C88 - ? -
32 Fugue 78.2930% -90 * C1 *1JJI - ? -
3 PsiBlast_PDB 77.7132% -99 - C1 -3ZWQ - ? -
2 PsiBlast_PDB 77.0532% -96 - C1 -2YH2 - ? -
47 HHSearch 75.3630% -88 - C1 -1LZL - ? -
46 HHSearch 74.7624% -90 - C1 -3GA7 - AES_SALTY -
49 HHSearch 74.6029% -95 - C1 -2HM7 - ? -
19 PsiBlast_PDB 73.1029%-102 - C1 -3AIM 4.1 ?
17 PsiBlast_PDB 72.1829% -99 - C1 -3AIL 3.7 ?
42 HHSearch 71.7826% -94 - C1 -3WJ1 - ? -
5 PsiBlast_PDB 71.7432% -96 - C1 -1EVQ 0.4 ?
20 PsiBlast_PDB 71.5929% -99 - C1 -3AIN - ? -
43 HHSearch 71.5125% -98 - C1 -3WJ2 - ? -
51 HHSearch 71.3225% -93 - C1 -1JKM - ? -
7 PsiBlast_PDB 69.5832% -92 - C1 -1QZ3 3.7 ?