@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0196: (2016-03-13 )
MEITDVRLRRVETDGRMKAISSITIDGEFVIHDIRVIDGNEGLFVAMPSKRTPDGEFRDIAHPINSGTRAKIQEAVLAAYEVADEPAVNEESSADESIVEEN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_3(2I9X)
SP5G_STAES
[Raw transfer]




EDO_A_3(2I9X)
SP5G_STAES
[Raw transfer]




EDO_B_5(2I9Z)
SP5G_STAES
[Raw transfer]




13 PsiBlast_CBE 93.2778%-142 - C5 -2IA9 - SP5G_BACSU -
17 HHSearch 92.9473%-131 - C5 -2IA9 - SP5G_BACSU -
2 PsiBlast_PDB 92.7364%-148 - C5 -2I9Z - SP5G_STAES -
3 PsiBlast_PDB 91.7068%-151 - C5 -2I9X 3.4 SP5G_STAES
1 PsiBlast_PDB 91.6578%-140 - C5 -2IA9 - SP5G_BACSU -
18 HHSearch 90.1771%-152 - C5 -2I9X 3.4 SP5G_STAES
14 PsiBlast_CBE 89.7878%-129 - C5 -2IA9 - SP5G_BACSU -
15 PsiBlast_CBE 84.4664%-138 - C5 -2I9Z 2.3 SP5G_STAES
16 PsiBlast_CBE 80.9273%-131 - C5 -2I9X - SP5G_STAES -
11 PsiBlast_PDB 41.6627%-104 * C4 *4NOV - ? -
40 Fugue 38.6330% -39 - C4 -1RK8 - WIBG_DROME -
12 PsiBlast_PDB 36.7135% -93 - C4 -4AK1 - ? -
32 HHSearch 31.4925% -50 - C5 -3WSW - ? -
38 Fugue 31.0515% -1 - C3 -4RL8 - ? -
29 HHSearch 30.9417% -17 - C5 -1EZ4 - LDH_LACPE -
21 HHSearch 30.6211% -42 - C5 -1LDN - LDH_GEOSE -
8 PsiBlast_PDB 29.8435% -20 - C5 -2ZDH - DDL_THET8 -
19 HHSearch 29.7714% -46 - C5 -1LLD - LDH2_BIFL2 -
39 Fugue 29.0815% -11 * C3 *3JTZ - ? -
26 HHSearch 28.9716% -28 - C5 -3D0O - LDH1_STAAC -