@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0200: (2016-03-13 )
MNAQAEEFKKYLETNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYKGAFVIMSGFIDTETSVGYYNLEVISEQATAYVIKINELKELLSKNLTHFFYVFQTLQKQVSYSLAKFNDFSINGKLGSICGQLLILTYVYGKETPDGIKITLDNLTMQELGYSSGIAHSSAVSRIISKLKQEKVIVYKNSCFYVQNLDYLKRYAPKLDEWFYLACPATWGKLN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_3(1OMI)
PRFA_LISMO
[Raw transfer]




GOL_C_3(1OMI)
PRFA_LISMO
[Raw transfer]




GOL_D_4(1OMI)
PRFA_LISMO
[Raw transfer]




1 PsiBlast_PDB 94.35100%-133 - C2 -2BEO - PRFA_LISMO -
45 Fugue 92.9599%-130 - C2 -1OMI 2.6 PRFA_LISMO
2 PsiBlast_PDB 92.6898%-130 - C2 -1OMI 2.6 PRFA_LISMO
22 PsiBlast_CBE 92.5798%-131 - C2 -1OMI 3.0 PRFA_LISMO
21 PsiBlast_CBE 92.30100%-130 - C2 -2BEO - PRFA_LISMO -
26 HHSearch 62.6318%-109 - C2 -2OZ6 - VFR_PSEAE -
3 PsiBlast_PDB 61.7824%-114 - C2 -2H6C - ? -
27 HHSearch 61.4921%-100 - C2 -2GAU - ? -
5 PsiBlast_PDB 60.7022%-101 - C2 -2GAU - ? -
29 HHSearch 58.2515% -97 * C2 *3I54 - CRPL_MYCTU -
33 HHSearch 58.2019%-102 - C2 -3LA7 - NTCA_NOSS1 -
35 HHSearch 58.0116%-106 - C2 -3KCC - CRP_ECOLI -
13 PsiBlast_PDB 57.4223%-113 - C2 -3E6D - ? -
11 PsiBlast_PDB 56.8023%-110 - C2 -3E6B - ? -
30 HHSearch 56.1919% -96 - C2 -3E6C - ? -
47 Fugue 56.1416%-103 - C2 -1O3T - CRP_ECOLI -
12 PsiBlast_PDB 55.9223% -99 - C2 -3E6C - ? -
14 PsiBlast_PDB 55.6523%-112 - C2 -2H6B - ? -
15 PsiBlast_PDB 55.5523%-105 - C2 -3E5Q - ? -
28 HHSearch 55.5214% -96 - C2 -3IWZ - CLP_XANCP -