Study : Lmo0210 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C6_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C6_S1
Complex: MPD_A_6(4M1Q) / Model_17(4M1Q/A) = [3.8] Download479.081.90MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID
Complex: NAD_D_13(3WSW) / Model_69(3WSW/D) = [5.7] Download2153.2521.07MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID
Complex: NAD_B_8(3WSW) / Model_71(3WSW/B) = [6.4] Download1644.3617.60MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID
Complex: NAD_Q_17(2LDB) / Model_59(2LDB/C) = [6.8] Download1818.9617.71MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID
Complex: NAD_P_16(2LDB) / Model_60(2LDB/B) = [6.8] Download1751.7817.71MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID
Consensus
[pKd Mean = 5.90]
-1569
(s=571)
15
(s=6)
MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID