@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0210: (2016-03-13 )
MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID

Atome Classification :

(57 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_E_5(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_G_7(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_E_5(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_H_8(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_A_7(3VPH)
LDH_THECA
[Raw transfer]




NAD_A_3(3H3J)
LDH1_STAAC
[Raw transfer]




NAD_A_3(3D4P)
LDH1_STAAC
[Raw transfer]




NAD_B_6(3H3J)
LDH1_STAAC
[Raw transfer]




NAD_F_6(1EZ4)
LDH_LACPE
[Raw transfer]




NAD_B_11(3VPH)
LDH_THECA
[Raw transfer]




NAD_D_16(3VPH)
LDH_THECA
[Raw transfer]




NAD_B_7(2XXJ)
LDH_THET8
[Raw transfer]




ENA_A_2(2X0J)
MDH_ARCFU
[Raw transfer]




NAD_C_10(2V7P)
LDH_THET8
[Raw transfer]




NAD_R_18(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_Q_17(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_O_15(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_B_5(3D4P)
LDH1_STAAC
[Raw transfer]




NAD_P_16(2LDB)
LDH_GEOSE
[Raw transfer]




NAD_R_21(1LTH)
LDH2_BIFL2
[Raw transfer]




NAD_A_6(2V7P)
LDH_THET8
[Raw transfer]




NAD_D_12(2V7P)
LDH_THET8
[Raw transfer]




NAD_D_10(2XXJ)
LDH_THET8
[Raw transfer]




NAD_C_5(3PQF)
LDH_BACSU
[Raw transfer]




NAD_D_6(3PQF)
LDH_BACSU
[Raw transfer]




NAD_B_8(3WSW)
?
[Raw transfer]




NAD_C_11(3WSW)
?
[Raw transfer]




NAD_A_5(3WSW)
?
[Raw transfer]




NAD_D_13(3WSW)
?
[Raw transfer]




NAD_A_5(3WSW)
?
[Raw transfer]




NAD_T_17(1LTH)
LDH2_BIFL2
[Raw transfer]




NAD_B_7(1LLD)
LDH2_BIFL2
[Raw transfer]




NAD_B_8(2V7P)
LDH_THET8
[Raw transfer]




NAD_A_5(1LLD)
LDH2_BIFL2
[Raw transfer]




NAD_A_5(1LLD)
LDH2_BIFL2
[Raw transfer]




OXM_C_13(3VPH)
LDH_THECA
[Raw transfer]




MPD_A_6(4M1Q)
?
[Raw transfer]




32 PsiBlast_CBE 95.5567%-122 - C6 -2ZQY - LDH_LACCA -
26 PsiBlast_CBE 95.3467%-122 - C6 -2ZQZ - LDH_LACCA -
36 PsiBlast_CBE 95.2066%-121 - C6 -3VPF - LDH_LACCA -
39 PsiBlast_CBE 94.8866%-123 - C6 -3VKU - LDH_LACCA -
40 PsiBlast_CBE 94.8666%-122 - C6 -3VKU - LDH_LACCA -
27 PsiBlast_CBE 94.5867%-120 - C6 -2ZQZ - LDH_LACCA -
23 PsiBlast_CBE 94.5567%-125 - C6 -3VKV - LDH_LACCA -
22 PsiBlast_CBE 94.4767%-122 - C6 -3VKV - LDH_LACCA -
28 PsiBlast_CBE 94.3067%-127 - C6 -2ZQZ - LDH_LACCA -
25 PsiBlast_CBE 93.9267%-124 - C6 -3VKV - LDH_LACCA -
31 PsiBlast_CBE 93.8267%-126 - C6 -2ZQY - LDH_LACCA -
21 PsiBlast_CBE 93.8067%-122 - C6 -3VKV - LDH_LACCA -
1 PsiBlast_PDB 93.7867%-126 - C6 -2ZQY - LDH_LACCA -
33 PsiBlast_CBE 93.7667%-125 - C6 -2ZQY - LDH_LACCA -
35 PsiBlast_CBE 93.7366%-123 - C6 -3VPF - LDH_LACCA -
43 PsiBlast_CBE 93.5966%-123 - C6 -3VKU - LDH_LACCA -
30 PsiBlast_CBE 93.4067%-121 - C6 -2ZQZ - LDH_LACCA -
2 PsiBlast_PDB 93.4067%-124 - C6 -2ZQZ - LDH_LACCA -
37 PsiBlast_CBE 93.3166%-119 - C6 -3VPF - LDH_LACCA -
3 PsiBlast_PDB 92.9567%-128 - C6 -3VKV - LDH_LACCA -
53 PsiBlast_CBE 91.5958%-124 - C6 -1EZ4 8.5 LDH_LACPE
51 PsiBlast_CBE 91.2158%-124 - C6 -1EZ4 8.3 LDH_LACPE
8 PsiBlast_PDB 90.5158%-129 - C6 -1EZ4 9.9 LDH_LACPE
110 HHSearch 90.4758%-128 - C6 -1EZ4 9.9 LDH_LACPE
54 PsiBlast_CBE 90.4259%-125 - C6 -3PQF 7.0 LDH_BACSU
13 PsiBlast_PDB 90.3258%-124 - C6 -3H3J 10.2 LDH1_STAAC
52 PsiBlast_CBE 90.1958%-128 - C6 -1EZ4 9.1 LDH_LACPE
12 PsiBlast_PDB 89.7558%-127 - C6 -3D4P 9.7 LDH1_STAAC
57 PsiBlast_CBE 89.6058%-124 - C6 -3H3J 10.4 LDH1_STAAC
56 PsiBlast_CBE 88.8958%-124 - C6 -3D4P 10.7 LDH1_STAAC
55 PsiBlast_CBE 88.8359%-124 - C6 -3PQF 8.1 LDH_BACSU
17 PsiBlast_PDB 88.8256%-128 - C6 -4M1Q 3.8 ?
60 PsiBlast_CBE 85.6457%-125 - C6 -2LDB 6.8 LDH_GEOSE
71 PsiBlast_CBE 85.3951%-118 - C6 -3WSW 6.4 ?
70 PsiBlast_CBE 85.2351%-123 - C6 -3WSW 8.0 ?
15 PsiBlast_PDB 85.1757%-125 - C6 -2LDB 7.1 LDH_GEOSE
59 PsiBlast_CBE 85.0857%-125 - C6 -2LDB 6.8 LDH_GEOSE
58 PsiBlast_CBE 85.0857%-125 - C6 -2LDB 7.0 LDH_GEOSE
69 PsiBlast_CBE 83.9851%-119 - C6 -3WSW 5.7 ?
72 PsiBlast_CBE 83.5951%-120 - C6 -3WSW 8.4 ?
117 HHSearch 83.3751%-116 - C6 -3WSW 8.4 ?
80 PsiBlast_CBE 79.2039%-104 - C6 -2V7P 11.1 LDH_THET8
93 PsiBlast_CBE 78.7139%-106 - C6 -3VPH 2.3 LDH_THECA
78 PsiBlast_CBE 78.2839% -99 - C6 -2V7P 10.2 LDH_THET8
88 PsiBlast_CBE 78.2639%-104 - C6 -2XXJ 10.5 LDH_THET8
95 PsiBlast_CBE 78.1539%-106 - C6 -3VPH 9.2 LDH_THECA
99 PsiBlast_CBE 77.8640%-116 - C6 -1LLD 7.9 LDH2_BIFL2
100 PsiBlast_CBE 77.5340%-120 - C6 -1LLD 7.9 LDH2_BIFL2
111 HHSearch 77.3639%-118 - C6 -1LLD 7.9 LDH2_BIFL2
92 PsiBlast_CBE 77.0739%-105 - C6 -3VPH 9.0 LDH_THECA
97 PsiBlast_CBE 76.9340%-116 - C6 -1LTH 8.9 LDH2_BIFL2
86 PsiBlast_CBE 76.9039%-100 - C6 -2XXJ 9.9 LDH_THET8
98 PsiBlast_CBE 76.7940%-107 - C6 -1LTH 8.2 LDH2_BIFL2
94 PsiBlast_CBE 76.1739%-103 - C6 -3VPH 9.5 LDH_THECA
77 PsiBlast_CBE 75.5739%-106 - C6 -2V7P 9.2 LDH_THET8
79 PsiBlast_CBE 74.9339%-111 - C6 -2V7P 8.2 LDH_THET8
104 HHSearch 70.5338%-100 - C6 -2X0J 10.3 MDH_ARCFU