@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0226: (2016-03-13 )
MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDAVGYEDQAAFLNIAVEIETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKERAFVMIPLIEISPEKSNLVENPALLEEQGVRKIKNQVNW

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PH2_A_6(1F9H)
HPPK_ECOLI
[Raw transfer]




PH2_A_3(3KUH)
HPPK_ECOLI
[Raw transfer]




PH2_A_10(1HQ2)
HPPK_ECOLI
[Raw transfer]




J1D_A_2(4PZV)
?
[Raw transfer]




HH2_A_3(1RAO)
HPPK_ECOLI
[Raw transfer]




HHR_A_6(1RU2)
HPPK_ECOLI
[Raw transfer]




YH1_A_3(4M5G)
HPPK_ECOLI
[Raw transfer]




YH3_A_6(4M5K)
HPPK_ECOLI
[Raw transfer]




YH6_A_6(4M5I)
HPPK_ECOLI
[Raw transfer]




YH4_A_7(4M5L)
HPPK_ECOLI
[Raw transfer]




PH2_A_3(3MCO)
?
[Raw transfer]




GSY_B_4(4AD6)
?
[Raw transfer]




GSY_A_3(4AD6)
?
[Raw transfer]




YH2_A_3(4M5H)
HPPK_ECOLI
[Raw transfer]




B55_A_3(3QBC)
?
[Raw transfer]




B55_B_4(3QBC)
?
[Raw transfer]




PE0_A_5(3HD2)
HPPK_ECOLI
[Raw transfer]




GOL_A_10(3HSD)
HPPK_ECOLI
[Raw transfer]




GOL_A_9(3HSD)
HPPK_ECOLI
[Raw transfer]




DX4_A_2(4M5M)
HPPK_ECOLI
[Raw transfer]




ATP_A_2(1DY3)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5J)
HPPK_ECOLI
[Raw transfer]




APC_C_15(4CYU)
?
[Raw transfer]




GOL_A_9(1RTZ)
HPPK_ECOLI
[Raw transfer]




APC_A_4(4CWB)
?
[Raw transfer]




APC_A_2(4CRJ)
?
[Raw transfer]




B57_B_5(3MCN)
?
[Raw transfer]




GOL_A_5(3HSJ)
HPPK_ECOLI
[Raw transfer]




YH7_A_6(4M5N)
HPPK_ECOLI
[Raw transfer]




APC_A_7(4CYU)
?
[Raw transfer]




YH7_B_10(4M5N)
HPPK_ECOLI
[Raw transfer]




APC_B_10(3MCO)
?
[Raw transfer]




APC_B_11(4CYU)
?
[Raw transfer]




ADP_A_4(1EQM)
HPPK_ECOLI
[Raw transfer]




APC_D_18(4CYU)
?
[Raw transfer]




EDO_A_4(3UD5)
HPPK_ECOLI
[Raw transfer]




EDO_A_3(3UD5)
HPPK_ECOLI
[Raw transfer]




TRS_A_4(3HSZ)
HPPK_ECOLI
[Raw transfer]




101 Fugue 94.6638%-115 - C8 -1Q0N - HPPK_ECOLI -
18 PsiBlast_PDB 91.7842%-132 - C8 -1Q0N - HPPK_ECOLI -
29 PsiBlast_CBE 91.5542%-146 - C8 -3UDE - HPPK_ECOLI -
27 PsiBlast_CBE 91.1842%-137 - C8 -4F7V - HPPK_ECOLI -
28 PsiBlast_CBE 90.5642%-143 - C8 -3UDV - HPPK_ECOLI -
51 PsiBlast_CBE 90.1641%-133 - C8 -3KUH 3.7 HPPK_ECOLI
48 PsiBlast_CBE 90.0841%-136 - C8 -1F9H 4.4 HPPK_ECOLI
4 PsiBlast_PDB 90.0447%-127 - C8 -4CRJ 7.1 ?
22 PsiBlast_CBE 89.8647%-128 - C8 -4CYU 5.4 ?
20 PsiBlast_PDB 89.8442%-135 - C8 -1RB0 - HPPK_ECOLI -
5 PsiBlast_PDB 89.7947%-125 - C8 -4CWB 7.1 ?
19 PsiBlast_PDB 89.7042%-146 - C8 -1RAO 4.5 HPPK_ECOLI
3 PsiBlast_PDB 89.3947%-119 - C8 -4AD6 3.7 ?
11 PsiBlast_PDB 89.3842%-129 - C8 -4M5L 5.1 HPPK_ECOLI
46 PsiBlast_CBE 89.2741%-147 - C8 -1G4C - HPPK_ECOLI -
49 PsiBlast_CBE 89.2241%-142 - C8 -3HT0 - HPPK_ECOLI -
8 PsiBlast_PDB 89.0142%-127 - C8 -4M5I 5.5 HPPK_ECOLI
21 PsiBlast_CBE 88.9447%-124 - C8 -4CYU 4.7 ?
12 PsiBlast_PDB 88.9142%-130 - C8 -4M5M 4.4 HPPK_ECOLI
7 PsiBlast_PDB 88.8142%-125 - C8 -4M5H 4.3 HPPK_ECOLI
30 PsiBlast_CBE 88.8042%-146 - C8 -3UD5 3.3 HPPK_ECOLI
35 PsiBlast_CBE 88.6941%-143 - C8 -3HD2 2.7 HPPK_ECOLI
6 PsiBlast_PDB 88.5742%-127 - C8 -4M5G 5.6 HPPK_ECOLI
32 PsiBlast_CBE 88.3942%-145 - C8 -3HSD 2.0 HPPK_ECOLI
24 PsiBlast_CBE 88.3947%-120 - C8 -4AD6 3.9 ?
9 PsiBlast_PDB 88.3942%-131 - C8 -4M5J 6.3 HPPK_ECOLI
26 PsiBlast_CBE 88.3742%-124 - C8 -4M5N 4.1 HPPK_ECOLI
2 PsiBlast_PDB 88.3247%-115 - C8 -3QBC 3.8 ?
25 PsiBlast_CBE 88.1747%-123 - C8 -3QBC 3.3 ?
10 PsiBlast_PDB 88.0642%-127 - C8 -4M5K 5.5 HPPK_ECOLI
23 PsiBlast_CBE 88.0447%-124 - C8 -4CYU 4.6 ?
13 PsiBlast_PDB 88.0042%-125 - C8 -4M5N 4.4 HPPK_ECOLI
45 PsiBlast_CBE 87.8541%-131 - C8 -1HQ2 3.8 HPPK_ECOLI
33 PsiBlast_CBE 87.7942%-135 - C8 -3HSD 2.1 HPPK_ECOLI
14 PsiBlast_PDB 87.6342%-129 - C8 -1DY3 7.0 HPPK_ECOLI
16 PsiBlast_PDB 87.3542%-138 - C8 -1EQM 3.4 HPPK_ECOLI
40 PsiBlast_CBE 87.2841%-143 - C8 -3HSJ 1.9 HPPK_ECOLI
50 PsiBlast_CBE 87.0641%-136 - C8 -3HSZ 3.4 HPPK_ECOLI
58 PsiBlast_CBE 87.0540%-158 - C8 -1RU2 4.9 HPPK_ECOLI
1 PsiBlast_PDB 86.3247%-128 - C8 -4CYU 6.0 ?
61 PsiBlast_CBE 85.1840%-140 - C8 -1RTZ 2.6 HPPK_ECOLI
62 PsiBlast_CBE 84.1838%-138 - C8 -4PZV 8.7 ?
64 PsiBlast_CBE 83.2436%-139 - C8 -3MCO 4.5 ?
65 PsiBlast_CBE 82.1136%-134 - C8 -3MCN 4.7 ?
63 PsiBlast_CBE 81.9236%-152 - C8 -3MCO 5.4 ?