@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0236: (2016-03-13 )
MIRIGQGYDVHKLAYDRDLIIGGVKIPYEKGLLGHSDADVLLHAITDAIIGAIGAGDIGHFFPDTDMVFKDADSAELLAEIWQKVEADGFRLGNLDATIIAEKPKMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK

Atome Classification :

(91 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUD_D_4(1U43)
ISPF_ECOLI
[Raw transfer]




CTP_B_6(3IEW)
ISPF_BURPS
[Raw transfer]




CDM_A_3(1U40)
ISPF_ECOLI
[Raw transfer]




1AA_C_15(2AMT)
ISPF_ECOLI
[Raw transfer]




GOL_C_9(3GHZ)
ISPF_SALTY
[Raw transfer]




CDP_A_4(1U3L)
ISPF_ECOLI
[Raw transfer]




GOL_A_4(3GHZ)
ISPF_SALTY
[Raw transfer]




1AA_E_17(2AMT)
ISPF_ECOLI
[Raw transfer]




CDP_C_9(3IEW)
ISPF_BURPS
[Raw transfer]




1AA_E_18(2AMT)
ISPF_ECOLI
[Raw transfer]




1AA_C_14(2AMT)
ISPF_ECOLI
[Raw transfer]




829_C_10(3KE1)
ISPF_BURP1
[Raw transfer]




1AA_D_19(2AMT)
ISPF_ECOLI
[Raw transfer]




829_A_5(3KE1)
ISPF_BURP1
[Raw transfer]




CDP_A_4(1YQN)
ISPF_ECOLI
[Raw transfer]




829_B_8(3KE1)
ISPF_BURP1
[Raw transfer]




CDP_A_4(1YQN)
ISPF_ECOLI
[Raw transfer]




AO9_A_9(3Q8H)
ISPF_BURPS
[Raw transfer]




C5P_C_15(1H48)
ISPF_ECOLI
[Raw transfer]




CDP_C_15(2UZH)
?
[Raw transfer]




AO9_B_11(3Q8H)
ISPF_BURPS
[Raw transfer]




C_A_3(1W55)
ISPDF_CAMJE
[Raw transfer]




CTP_A_2(3FPI)
ISPF_YERPE
[Raw transfer]




C5P_A_9(1H48)
ISPF_ECOLI
[Raw transfer]




C5P_F_26(1H48)
ISPF_ECOLI
[Raw transfer]




C5P_C_14(4C8E)
ISPF_BURCJ
[Raw transfer]




AO9_A_5(3Q8H)
ISPF_BURPS
[Raw transfer]




CDP_A_5(3IEW)
ISPF_BURPS
[Raw transfer]




C5P_D_16(1H47)
ISPF_ECOLI
[Raw transfer]




1AA_A_13(2AMT)
ISPF_ECOLI
[Raw transfer]




C5P_C_12(1H47)
ISPF_ECOLI
[Raw transfer]




C5P_E_14(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_F_19(1H47)
ISPF_ECOLI
[Raw transfer]




F01_A_5(3ELC)
ISPF_ECOLI
[Raw transfer]




C5P_D_12(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_B_8(4C8E)
ISPF_BURCJ
[Raw transfer]




C5P_B_7(4C8G)
ISPF_BURCJ
[Raw transfer]




C5P_F_16(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_C_11(4C8G)
ISPF_BURCJ
[Raw transfer]




CTN_B_17(3T80)
ISPF_SALTY
[Raw transfer]




CTN_B_9(3P10)
ISPF_BURP1
[Raw transfer]




C5P_C_13(4C8E)
ISPF_BURCJ
[Raw transfer]




I5A_B_9(3K2X)
ISPF_BURP1
[Raw transfer]




C5P_C_10(3F0G)
ISPF_BURP1
[Raw transfer]




C5P_E_17(1H47)
ISPF_ECOLI
[Raw transfer]




CTN_B_9(3P0Z)
ISPF_BURP1
[Raw transfer]




CTN_B_11(3QHD)
ISPF_BURP1
[Raw transfer]




C5P_A_9(1H47)
ISPF_ECOLI
[Raw transfer]




F01_B_7(3ELC)
ISPF_ECOLI
[Raw transfer]




C5P_A_5(4C8G)
ISPF_BURCJ
[Raw transfer]




C5P_A_5(2PMP)
ISPF_ARATH
[Raw transfer]




CAR_E_16(3ERN)
ISPF_ECOLI
[Raw transfer]




CIT_C_8(4C8I)
ISPF_BURCJ
[Raw transfer]




CIT_B_6(4C8I)
ISPF_BURCJ
[Raw transfer]




C5P_D_19(1H48)
ISPF_ECOLI
[Raw transfer]




C5P_B_12(1H48)
ISPF_ECOLI
[Raw transfer]




C_B_8(3IEQ)
ISPF_BURP1
[Raw transfer]




CTN_C_12(3P0Z)
ISPF_BURP1
[Raw transfer]




CTN_A_7(3P0Z)
ISPF_BURP1
[Raw transfer]




CAR_A_8(3ERN)
ISPF_ECOLI
[Raw transfer]




CTN_C_12(3P10)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3P10)
ISPF_BURP1
[Raw transfer]




I5A_A_5(3K2X)
ISPF_BURP1
[Raw transfer]




CTN_A_6(3QHD)
ISPF_BURP1
[Raw transfer]




CTN_C_13(3QHD)
ISPF_BURP1
[Raw transfer]




717_C_11(3MBM)
ISPF_BURP1
[Raw transfer]




I5A_C_11(3K2X)
ISPF_BURP1
[Raw transfer]




C_C_10(3IEQ)
ISPF_BURP1
[Raw transfer]




HHV_A_5(3JVH)
ISPF_BURP1
[Raw transfer]




CTN_A_10(3T80)
ISPF_SALTY
[Raw transfer]




F01_C_9(3ELC)
ISPF_ECOLI
[Raw transfer]




717_A_6(3MBM)
ISPF_BURP1
[Raw transfer]




C5P_E_23(1H48)
ISPF_ECOLI
[Raw transfer]




HHV_C_10(3JVH)
ISPF_BURP1
[Raw transfer]




C_A_4(3IEQ)
ISPF_BURP1
[Raw transfer]




535_C_11(3K14)
ISPF_BURP1
[Raw transfer]




CIT_A_4(4C8I)
ISPF_BURCJ
[Raw transfer]




CAR_B_9(3ERN)
ISPF_ECOLI
[Raw transfer]




CAR_D_15(3ERN)
ISPF_ECOLI
[Raw transfer]




535_A_5(3K14)
ISPF_BURP1
[Raw transfer]




535_B_9(3K14)
ISPF_BURP1
[Raw transfer]




HHV_B_8(3JVH)
ISPF_BURP1
[Raw transfer]




717_B_10(3MBM)
ISPF_BURP1
[Raw transfer]




CAR_C_13(3ERN)
ISPF_ECOLI
[Raw transfer]




47 PsiBlast_CBE 98.0662%-119 - C10 -3ERN - ISPF_ECOLI -
51 PsiBlast_CBE 97.8462%-121 - C10 -3ELC 3.2 ISPF_ECOLI
31 PsiBlast_CBE 97.5662%-120 - C10 -1H48 3.0 ISPF_ECOLI
102 HHSearch 97.5561%-117 - C10 -1T0A - ISPF_SHEON -
34 PsiBlast_CBE 97.3562%-118 - C10 -1H48 3.1 ISPF_ECOLI
90 PsiBlast_CBE 97.0958%-122 - C10 -3JVH 2.6 ISPF_BURP1
96 PsiBlast_CBE 97.0458%-124 - C10 -3IEQ 3.5 ISPF_BURP1
39 PsiBlast_CBE 96.9862%-121 - C10 -1H47 3.1 ISPF_ECOLI
10 PsiBlast_PDB 96.9262%-120 - C10 -1H48 3.0 ISPF_ECOLI
28 PsiBlast_CBE 96.8862%-116 - C10 -3GHZ 2.3 ISPF_SALTY
20 PsiBlast_PDB 96.7662%-120 - C10 -3ESJ - ISPF_ECOLI -
32 PsiBlast_CBE 96.7062%-116 - C10 -1H48 2.9 ISPF_ECOLI
93 PsiBlast_CBE 96.6458%-121 - C10 -3IEW 3.0 ISPF_BURPS
87 PsiBlast_CBE 96.6258%-123 - C10 -3K14 1.8 ISPF_BURP1
6 PsiBlast_PDB 96.6262%-117 - C10 -3T80 - ISPF_SALTY -
4 PsiBlast_PDB 96.6160%-117 - C10 -1T0A - ISPF_SHEON -
5 PsiBlast_PDB 96.5562%-118 - C10 -3GHZ 3.3 ISPF_SALTY
106 HHSearch 96.5458%-123 - C10 -3F0D - ISPF_BURP1 -
19 PsiBlast_PDB 96.4562%-120 - C10 -3ERN 2.6 ISPF_ECOLI
9 PsiBlast_PDB 96.3662%-121 - C10 -1H47 - ISPF_ECOLI -
48 PsiBlast_CBE 96.2062%-117 - C10 -3ERN 2.8 ISPF_ECOLI
50 PsiBlast_CBE 96.1862%-119 - C10 -3ERN 2.6 ISPF_ECOLI
43 PsiBlast_CBE 96.1762%-118 - C10 -2AMT 4.1 ISPF_ECOLI
55 PsiBlast_CBE 96.1658%-114 - C10 -4C8I 3.0 ISPF_BURCJ
36 PsiBlast_CBE 96.0762%-120 - C10 -1H47 3.1 ISPF_ECOLI
72 PsiBlast_CBE 95.9858%-122 - C10 -3P10 3.3 ISPF_BURP1
15 PsiBlast_PDB 95.9762%-118 - C10 -1U43 2.9 ISPF_ECOLI
33 PsiBlast_CBE 95.8962%-116 - C10 -1H48 3.0 ISPF_ECOLI
37 PsiBlast_CBE 95.8862%-118 - C10 -1H47 3.1 ISPF_ECOLI
78 PsiBlast_CBE 95.7758%-122 - C10 -3MBM 3.2 ISPF_BURP1
66 PsiBlast_CBE 95.7458%-123 - C10 -3QHD 3.5 ISPF_BURP1
52 PsiBlast_CBE 95.7162%-118 - C10 -3ELC 3.2 ISPF_ECOLI
75 PsiBlast_CBE 95.7058%-123 - C10 -3P0Z 3.3 ISPF_BURP1
30 PsiBlast_CBE 95.6262%-119 - C10 -1H48 3.1 ISPF_ECOLI
84 PsiBlast_CBE 95.6058%-125 - C10 -3K2X 4.0 ISPF_BURP1
16 PsiBlast_PDB 95.5462%-119 - C10 -2AMT 3.5 ISPF_ECOLI
12 PsiBlast_PDB 95.4462%-123 - C10 -1U3L 3.6 ISPF_ECOLI
99 PsiBlast_CBE 95.4158%-116 - C10 -3F0G 3.4 ISPF_BURP1
38 PsiBlast_CBE 95.4162%-119 - C10 -1H47 3.3 ISPF_ECOLI
40 PsiBlast_CBE 95.3262%-115 - C10 -2AMT 4.0 ISPF_ECOLI
17 PsiBlast_PDB 95.3262%-117 - C10 -3ELC 3.1 ISPF_ECOLI
64 PsiBlast_CBE 95.1458%-119 - C10 -3QHD 3.6 ISPF_BURP1
35 PsiBlast_CBE 95.0562%-116 - C10 -1H47 3.3 ISPF_ECOLI
41 PsiBlast_CBE 95.0062%-120 - C10 -2AMT 4.2 ISPF_ECOLI
14 PsiBlast_PDB 94.9662%-120 - C10 -1U40 3.3 ISPF_ECOLI
44 PsiBlast_CBE 94.9162%-118 - C10 -2AMT 3.4 ISPF_ECOLI
62 PsiBlast_CBE 94.7058%-117 - C10 -4C8E 3.3 ISPF_BURCJ
49 PsiBlast_CBE 94.6062%-122 - C10 -3ERN 3.1 ISPF_ECOLI
8 PsiBlast_PDB 94.5760%-119 - C10 -3FPI 3.3 ISPF_YERPE
71 PsiBlast_CBE 94.5458%-118 - C10 -3P10 3.7 ISPF_BURP1
73 PsiBlast_CBE 94.4358%-125 - C10 -3P0Z 3.4 ISPF_BURP1
103 HHSearch 94.4261%-117 - C10 -1YQN 3.5 ISPF_ECOLI
42 PsiBlast_CBE 94.3562%-113 - C10 -2AMT 4.1 ISPF_ECOLI
26 PsiBlast_CBE 94.2162%-118 - C10 -3T80 3.1 ISPF_SALTY
83 PsiBlast_CBE 94.1958%-123 - C10 -3K2X 4.0 ISPF_BURP1
54 PsiBlast_CBE 94.1458%-116 - C10 -4C8I 4.2 ISPF_BURCJ
81 PsiBlast_CBE 94.1058%-126 - C10 -3KE1 3.2 ISPF_BURP1
67 PsiBlast_CBE 94.1058%-119 - C10 -3Q8H 3.8 ISPF_BURPS
88 PsiBlast_CBE 93.9958%-120 - C10 -3JVH 3.1 ISPF_BURP1
89 PsiBlast_CBE 93.8858%-123 - C10 -3JVH 3.1 ISPF_BURP1
92 PsiBlast_CBE 93.7958%-127 - C10 -3IEW 3.9 ISPF_BURPS
70 PsiBlast_CBE 93.7458%-123 - C10 -3P10 3.4 ISPF_BURP1
63 PsiBlast_CBE 93.7060%-117 - C10 -1YQN 3.5 ISPF_ECOLI
80 PsiBlast_CBE 93.6658%-123 - C10 -3KE1 3.2 ISPF_BURP1
60 PsiBlast_CBE 93.6658%-116 - C10 -4C8E 3.9 ISPF_BURCJ
46 PsiBlast_CBE 93.5762%-127 - C10 -3ERN 3.0 ISPF_ECOLI
76 PsiBlast_CBE 93.5258%-119 - C10 -3MBM 3.2 ISPF_BURP1
68 PsiBlast_CBE 93.5258%-121 - C10 -3Q8H 3.6 ISPF_BURPS
59 PsiBlast_CBE 93.3458%-124 - C10 -4C8G 3.1 ISPF_BURCJ
77 PsiBlast_CBE 93.2858%-121 - C10 -3MBM 2.9 ISPF_BURP1
58 PsiBlast_CBE 93.2858%-127 - C10 -4C8G 3.4 ISPF_BURCJ
101 PsiBlast_CBE 93.0058%-122 - C10 -3F0G 3.1 ISPF_BURP1
57 PsiBlast_CBE 92.9658%-120 - C10 -4C8G 3.2 ISPF_BURCJ
61 PsiBlast_CBE 92.8558%-116 - C10 -4C8E 3.4 ISPF_BURCJ
85 PsiBlast_CBE 92.6758%-122 - C10 -3K14 2.7 ISPF_BURP1
86 PsiBlast_CBE 92.5558%-126 - C10 -3K14 3.1 ISPF_BURP1
98 PsiBlast_CBE 92.1258%-119 - C10 -3F0G 3.1 ISPF_BURP1
95 PsiBlast_CBE 92.0558%-122 - C10 -3IEQ 3.6 ISPF_BURP1
82 PsiBlast_CBE 92.0558%-128 - C10 -3K2X 3.5 ISPF_BURP1
97 PsiBlast_CBE 92.0258%-123 - C10 -3F0G 2.8 ISPF_BURP1
56 PsiBlast_CBE 91.8158%-117 - C10 -4C8I 3.6 ISPF_BURCJ
91 PsiBlast_CBE 91.5958%-121 - C10 -3IEW 3.2 ISPF_BURPS
27 PsiBlast_CBE 91.5562%-118 - C10 -3T80 3.1 ISPF_SALTY
94 PsiBlast_CBE 91.5358%-122 - C10 -3IEQ 3.2 ISPF_BURP1
74 PsiBlast_CBE 91.5158%-122 - C10 -3P0Z 3.7 ISPF_BURP1
79 PsiBlast_CBE 91.0758%-124 - C10 -3KE1 2.9 ISPF_BURP1
69 PsiBlast_CBE 89.4458%-128 - C10 -3Q8H 3.4 ISPF_BURPS
110 HHSearch 88.5150%-117 - C10 -1W55 3.5 ISPDF_CAMJE
65 PsiBlast_CBE 87.4158%-120 - C10 -3QHD 3.7 ISPF_BURP1
104 HHSearch 85.9745%-117 - C10 -2PMP 3.4 ISPF_ARATH
107 HHSearch 79.9336%-114 - C10 -2UZH 3.4 ?