@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0300: (2016-03-14 )
MNNNFLWGGATASYQCEGAWDVDGKAESMWDYYLHEAGLENGDVASDHYHRYEEDIRMMKEGGQNSYRFSLSWPRIIKNRQGDINLKGIEFYQNLLDTCKKYDIEPFVTLYHWDLPQYWEETGGWLDHDVCAAFEHYAKVCYDHFGDKITNWTTFNEPKWFVANGYKIGNYPPGYQDTQKTMIAAYNVMYASALGVKAFKEGGYPGQIGIVHSYTPVNGIDESIETKIAMRYADNYCNNWILDTAALGEFPVDLIAELAKSHDISFMKTDELQTIKQNTVDFIGLNYYSRTLVKPYTGGETQLQFNHSGKKGESKVLIKNWFEQVKDPANETTEWDTEIYPKGLQDGLIEAYERYQLPLYVTENGIGVREDVSVPQVDDAYRIAFMNDHINAIFNAIDAGCDVRGYYAWSPFDLYSWKNGVEKRYGLVAVDFENNQIRKPKASYYWFKEMIESQGKLIKRREF

Atome Classification :

(70 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOX_A_7(2J78)
BGLA_THEMA
[Raw transfer]




GIM_B_7(2CES)
BGLA_THEMA
[Raw transfer]




PGI_B_6(2CET)
BGLA_THEMA
[Raw transfer]




GIM_A_4(2CES)
BGLA_THEMA
[Raw transfer]




GOX_B_9(2J78)
BGLA_THEMA
[Raw transfer]




GI4_B_5(2J7G)
BGLA_THEMA
[Raw transfer]




BGC_A_2(4HZ8)
?
[Raw transfer]




NTZ_B_5(2J7B)
BGLA_THEMA
[Raw transfer]




TCB_B_6(4PTV)
?
[Raw transfer]




NOY_B_6(2J75)
BGLA_THEMA
[Raw transfer]




NOY_A_4(2J75)
BGLA_THEMA
[Raw transfer]




TCB_A_3(4PTV)
?
[Raw transfer]




GI1_B_5(2J7D)
BGLA_THEMA
[Raw transfer]




CTS_B_6(2CBU)
BGLA_THEMA
[Raw transfer]




IDE_B_5(2J7C)
BGLA_THEMA
[Raw transfer]




NOJ_A_3(1OIM)
BGLA_THEMA
[Raw transfer]




IFL_B_4(1UZ1)
BGLA_THEMA
[Raw transfer]




CGB_B_5(2CBV)
BGLA_THEMA
[Raw transfer]




GTL_B_5(2J79)
BGLA_THEMA
[Raw transfer]




IFL_A_3(1UZ1)
BGLA_THEMA
[Raw transfer]




CGB_A_3(2CBV)
BGLA_THEMA
[Raw transfer]




GI4_A_3(2J7G)
BGLA_THEMA
[Raw transfer]




GI2_B_5(2J7E)
BGLA_THEMA
[Raw transfer]




GTL_A_3(2J79)
BGLA_THEMA
[Raw transfer]




BGC_A_2(3WH6)
?
[Raw transfer]




NOJ_B_5(2J77)
BGLA_THEMA
[Raw transfer]




CTS_A_3(2CBU)
BGLA_THEMA
[Raw transfer]




GOX_A_7(2J78)
BGLA_THEMA
[Raw transfer]




NOJ_B_4(1OIM)
BGLA_THEMA
[Raw transfer]




BGC_A_2(4HZ7)
?
[Raw transfer]




OXZ_A_3(1W3J)
BGLA_THEMA
[Raw transfer]




OXZ_B_4(1W3J)
BGLA_THEMA
[Raw transfer]




GLC_A_2(2O9T)
BGLB_PAEPO
[Raw transfer]




AZF_B_7(2J7H)
BGLA_THEMA
[Raw transfer]




SRT_A_24(3CMJ)
?
[Raw transfer]




IFM_A_3(1OIF)
BGLA_THEMA
[Raw transfer]




BGP_B_4(4PBG)
LACG_LACLL
[Raw transfer]




IFM_B_4(1OIF)
BGLA_THEMA
[Raw transfer]




GOL_A_3(3WH5)
?
[Raw transfer]




GOL_A_3(3AIU)
HGGL_SECCE
[Raw transfer]




BGP_A_3(4PBG)
LACG_LACLL
[Raw transfer]




YLL_B_6(2JAL)
BGLA_THEMA
[Raw transfer]




IFM_A_3(3WH8)
?
[Raw transfer]




GOL_A_4(1WCG)
MYRO1_BREBR
[Raw transfer]




BGC_A_3(1V03)
?
[Raw transfer]




BGC_A_3(4PTX)
?
[Raw transfer]




FCB_A_2(3WH7)
?
[Raw transfer]




NCW_A_3(2VRJ)
BGLA_THEMA
[Raw transfer]




BGC_B_5(4PTX)
?
[Raw transfer]




G2F_A_9(1E4I)
BGLA_PAEPO
[Raw transfer]




NCW_B_7(2VRJ)
BGLA_THEMA
[Raw transfer]




G2F_A_3(1OIN)
BGLA_THEMA
[Raw transfer]




G2F_A_9(1E4I)
BGLA_PAEPO
[Raw transfer]




G2F_A_2(3AIR)
HGL1B_WHEAT
[Raw transfer]




G2F_A_2(2JIE)
BGLB_PAEPO
[Raw transfer]




G2F_B_4(1OIN)
BGLA_THEMA
[Raw transfer]




G2F_A_9(1UYQ)
BGLA_PAEPO
[Raw transfer]




G2F_A_3(4PTW)
?
[Raw transfer]




G2F_B_5(4PTW)
?
[Raw transfer]




G2F_A_3(3AIW)
HGGL_SECCE
[Raw transfer]




121 Fugue 95.4638% -71 - C3 -1GNX - ? -
18 PsiBlast_PDB 95.0737% -68 - C3 -1GNX - ? -
41 PsiBlast_CBE 94.5037% -67 - C3 -1GNX - ? -
19 PsiBlast_PDB 94.4037% -69 - C3 -1GON - ? -
8 PsiBlast_PDB 93.6236% -64 - C3 -4PBG 5.1 LACG_LACLL
30 PsiBlast_CBE 93.4936% -65 - C3 -4PBG 3.1 LACG_LACLL
28 PsiBlast_CBE 93.2136% -63 - C3 -3PBG - LACG_LACLL -
24 PsiBlast_CBE 93.2138% -72 - C3 -4PTV 4.4 ?
7 PsiBlast_PDB 92.9136% -64 - C3 -3PBG - LACG_LACLL -
6 PsiBlast_PDB 92.7036% -65 - C3 -2PBG - LACG_LACLL -
22 PsiBlast_CBE 92.6938% -70 - C3 -4PTX 3.7 ?
4 PsiBlast_PDB 92.6638% -72 - C3 -4PTX 3.9 ?
85 PsiBlast_CBE 92.6136% -75 - C3 -1OIN 2.7 BGLA_THEMA
12 PsiBlast_PDB 92.5135% -72 - C3 -4HZ8 4.2 ?
29 PsiBlast_CBE 92.4636% -69 - C3 -1PBG - LACG_LACLL -
27 PsiBlast_CBE 92.4538% -65 - C3 -3AHX - ? -
2 PsiBlast_PDB 92.3738% -72 - C3 -4PTV 4.8 ?
68 PsiBlast_CBE 92.3136% -74 - C3 -2J79 4.1 BGLA_THEMA
11 PsiBlast_PDB 92.2735% -74 - C3 -4HZ7 4.0 ?
26 PsiBlast_CBE 92.2538% -63 - C3 -3AHX - ? -
23 PsiBlast_CBE 92.1438% -70 - C3 -4PTW 2.5 ?
3 PsiBlast_PDB 92.0938% -71 - C3 -4PTW 2.9 ?
61 PsiBlast_CBE 92.0536% -74 - C3 -2J7G 5.3 BGLA_THEMA
77 PsiBlast_CBE 91.9836% -73 - C3 -2CBV 4.2 BGLA_THEMA
72 PsiBlast_CBE 91.8336% -73 - C3 -2J75 4.4 BGLA_THEMA
63 PsiBlast_CBE 91.6736% -72 - C3 -2J7E 5.0 BGLA_THEMA
44 PsiBlast_CBE 91.6332% -73 - C3 -2O9T 3.4 BGLB_PAEPO
9 PsiBlast_PDB 91.6135% -72 - C3 -3CMJ 3.1 ?
88 PsiBlast_CBE 91.5436% -75 - C3 -1OIM 4.4 BGLA_THEMA
83 PsiBlast_CBE 91.5336% -74 - C3 -1UZ1 4.0 BGLA_THEMA
75 PsiBlast_CBE 91.4936% -71 - C3 -2CES 4.6 BGLA_THEMA
89 PsiBlast_CBE 91.3836% -75 - C3 -1OIF 3.7 BGLA_THEMA
67 PsiBlast_CBE 91.3436% -74 - C3 -2J79 4.1 BGLA_THEMA
73 PsiBlast_CBE 91.2836% -74 - C3 -2J75 4.3 BGLA_THEMA
90 PsiBlast_CBE 91.2236% -75 - C3 -1OIF 3.9 BGLA_THEMA
76 PsiBlast_CBE 91.1836% -73 - C3 -2CES 5.0 BGLA_THEMA
60 PsiBlast_CBE 91.1636% -73 - C3 -2J7H 3.6 BGLA_THEMA
80 PsiBlast_CBE 91.1436% -75 - C3 -2CBU 4.9 BGLA_THEMA
58 PsiBlast_CBE 91.1436% -75 - C3 -2VRJ 3.2 BGLA_THEMA
20 PsiBlast_PDB 91.0732% -74 - C3 -2JIE 2.0 BGLB_PAEPO
62 PsiBlast_CBE 91.0536% -75 - C3 -2J7G 4.4 BGLA_THEMA
57 PsiBlast_CBE 91.0536% -74 - C3 -2VRJ 3.7 BGLA_THEMA
74 PsiBlast_CBE 91.0436% -73 - C3 -2CET 4.5 BGLA_THEMA
84 PsiBlast_CBE 91.0236% -75 - C3 -1UZ1 4.0 BGLA_THEMA
65 PsiBlast_CBE 91.0036% -72 - C3 -2J7C 5.0 BGLA_THEMA
79 PsiBlast_CBE 90.9036% -73 - C3 -2CBU 4.7 BGLA_THEMA
69 PsiBlast_CBE 90.8536% -74 - C3 -2J78 4.7 BGLA_THEMA
59 PsiBlast_CBE 90.7536% -72 - C3 -2JAL 3.7 BGLA_THEMA
70 PsiBlast_CBE 90.6936% -74 - C3 -2J78 4.7 BGLA_THEMA
78 PsiBlast_CBE 90.6536% -72 - C3 -2CBV 4.0 BGLA_THEMA
66 PsiBlast_CBE 90.6436% -72 - C3 -2J7B 4.5 BGLA_THEMA
71 PsiBlast_CBE 90.6236% -74 - C3 -2J77 4.2 BGLA_THEMA
87 PsiBlast_CBE 90.4936% -71 - C3 -1OIM 4.2 BGLA_THEMA
82 PsiBlast_CBE 90.4836% -71 - C3 -1W3J 3.8 BGLA_THEMA
64 PsiBlast_CBE 90.4736% -72 - C3 -2J7D 4.3 BGLA_THEMA
81 PsiBlast_CBE 90.3736% -73 - C3 -1W3J 3.8 BGLA_THEMA
117 HHSearch 90.2835% -69 - C3 -1E4I 2.9 BGLA_PAEPO
86 PsiBlast_CBE 89.9636% -74 - C3 -1OIN 3.2 BGLA_THEMA
13 PsiBlast_PDB 88.2335% -63 - C3 -1E4I 2.4 BGLA_PAEPO
92 PsiBlast_CBE 88.1732% -57 - C3 -3AIW 2.9 HGGL_SECCE
15 PsiBlast_PDB 87.9835% -64 - C3 -1UYQ 2.6 BGLA_PAEPO
36 PsiBlast_CBE 87.8234% -68 - C3 -3WH6 4.2 ?
119 HHSearch 87.6435% -67 * C3 *2J78 3.4 BGLA_THEMA
34 PsiBlast_CBE 87.5534% -66 - C3 -3WH8 3.7 ?
37 PsiBlast_CBE 87.4134% -68 - C3 -3WH5 2.6 ?
35 PsiBlast_CBE 87.3234% -67 - C3 -3WH7 3.7 ?
94 PsiBlast_CBE 86.9232% -56 - C3 -3AIU 2.4 HGGL_SECCE
96 PsiBlast_CBE 86.6632% -56 - C3 -3AIR 2.2 HGL1B_WHEAT
118 HHSearch 85.0232% -63 - C3 -1WCG 2.6 MYRO1_BREBR
91 PsiBlast_CBE 82.9633% -53 - C3 -1V03 3.7 ?