@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0317: (2016-03-14 )
MTFPQVLTIAGSDSGGGAGIQADIKTFQERRTFGMSVITAITAQNTLGVKAVHKIPVEMIREQCDAIAEDFQVSAVKTGMLADAEIIREVVRNIRLHNFPNLVIDPVMIAKGGTALLENEATQVLKDELLPLGTIITPNIPEAEEILGEKITTKAEIERAAKKIYDMGVKAVVIKGGHSEMTEAADFYFDGVTAKWLTSERFDTPHTHGTGCTFSACIAAELAKGNSLLDSVMVAKEFISSAIKYPLGIGHGHGPTNHFAYRMEDGK

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_H_8(2I5B)
PDXK_BACSU
[Raw transfer]




ACP_B_8(4C5N)
?
[Raw transfer]




ACP_C_12(4C5N)
?
[Raw transfer]




ACP_D_16(4C5N)
?
[Raw transfer]




ACP_A_6(4C5N)
?
[Raw transfer]




ADP_I_9(2I5B)
PDXK_BACSU
[Raw transfer]




ADP_G_7(2I5B)
PDXK_BACSU
[Raw transfer]




UEG_A_5(4C5L)
?
[Raw transfer]




ADP_B_9(4C5K)
?
[Raw transfer]




ADP_C_13(4C5K)
?
[Raw transfer]




UEG_C_10(4C5L)
?
[Raw transfer]




ACP_B_10(4C5M)
?
[Raw transfer]




ADP_D_17(4C5K)
?
[Raw transfer]




UEG_D_11(4C5L)
?
[Raw transfer]




ACP_D_20(4C5M)
?
[Raw transfer]




ACP_A_5(4C5M)
?
[Raw transfer]




HMH_H_8(1JXI)
THID_SALTY
[Raw transfer]




GOL_A_8(1UB0)
?
[Raw transfer]




HMH_G_7(1JXI)
THID_SALTY
[Raw transfer]




2 PsiBlast_PDB 86.3345% -82 - C1 -2I5B - PDXK_BACSU -
24 PsiBlast_CBE 86.1845% -81 - C1 -2I5B 6.1 PDXK_BACSU
22 PsiBlast_CBE 86.1845% -82 - C1 -2I5B - PDXK_BACSU -
23 PsiBlast_CBE 85.6445% -81 - C1 -2I5B 6.5 PDXK_BACSU
79 HHSearch 84.6148% -84 - C1 -1UB0 2.7 ?
80 HHSearch 83.9746% -77 - C1 -2I5B 6.3 PDXK_BACSU
25 PsiBlast_CBE 83.4745% -81 - C1 -2I5B - PDXK_BACSU -
10 PsiBlast_PDB 83.0848% -84 - C1 -1UB0 - ? -
21 PsiBlast_CBE 81.2750%-104 - C1 -4JJP - ? -
36 PsiBlast_CBE 80.8839% -79 - C1 -4C5K 5.1 ?
38 PsiBlast_CBE 80.6039% -80 - C1 -4C5K 5.9 ?
6 PsiBlast_PDB 79.7939% -80 - C1 -4C5K - ? -
33 PsiBlast_CBE 79.4439% -80 - C1 -4C5M 5.6 ?
32 PsiBlast_CBE 79.2639% -80 - C1 -4C5M - ? -
8 PsiBlast_PDB 79.2539% -80 - C1 -4C5M 5.5 ?
1 PsiBlast_PDB 79.2350% -93 - C1 -4JJP - ? -
29 PsiBlast_CBE 79.1139% -79 - C1 -4C5N 6.6 ?
40 PsiBlast_CBE 79.0439% -79 - C1 -4C5J - ? -
37 PsiBlast_CBE 78.8339% -80 - C1 -4C5K 5.9 ?
5 PsiBlast_PDB 78.3939% -77 - C1 -4C5J - ? -
31 PsiBlast_CBE 77.8139% -80 * C1 *4C5M 5.3 ?
30 PsiBlast_CBE 77.6139% -81 - C1 -4C5N 5.9 ?
28 PsiBlast_CBE 77.4539% -80 - C1 -4C5N 5.3 ?
9 PsiBlast_PDB 77.4239% -82 - C1 -4C5N 5.9 ?
26 PsiBlast_CBE 77.0040% -84 - C1 -1JXI 3.3 THID_SALTY
7 PsiBlast_PDB 76.1739% -77 - C1 -4C5L 2.6 ?
4 PsiBlast_PDB 76.0240% -84 - C1 -1JXI 3.4 THID_SALTY
34 PsiBlast_CBE 75.3739% -72 - C1 -4C5L 2.4 ?
35 PsiBlast_CBE 74.8239% -72 - C1 -4C5L 2.7 ?