@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0343: (2016-03-14 )
MKFFLDTASVSEIKRISELGLVDGVTTNPTIIAKEGRPFEEVIKEICSIVDGPVSAEVIGLEADKMVEEARILAKWAPNVVVKIPMTEEGLKAVHTLTAEGIKTNVTLIFTVSQGLMAAKAGATYISPFLGRLDDIGTDGMILIKNLKKVLDNYGLKAEIISASIRHIGHLEEAAEAGAHIATIPGSLFPKLWSHPLTDKGIEGFLKDWEAFSQKEGN

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

I22_C_8(3S1X)
TAL_THEAC
[Raw transfer]




I22_E_10(3S1X)
TAL_THEAC
[Raw transfer]




I22_A_6(3S1X)
TAL_THEAC
[Raw transfer]




I22_D_9(3S1X)
TAL_THEAC
[Raw transfer]




I22_B_7(3S1X)
TAL_THEAC
[Raw transfer]




I22_A_6(3S1X)
TAL_THEAC
[Raw transfer]




I22_A_3(3TKF)
?
[Raw transfer]




F6R_E_13(3S1V)
TAL_THEAC
[Raw transfer]




F6R_C_11(3S1V)
TAL_THEAC
[Raw transfer]




F6R_B_10(3S1V)
TAL_THEAC
[Raw transfer]




E4P_E_11(3S1U)
TAL_THEAC
[Raw transfer]




F6R_D_12(3S1V)
TAL_THEAC
[Raw transfer]




F6R_A_8(3S1V)
TAL_THEAC
[Raw transfer]




E4P_C_9(3S1U)
TAL_THEAC
[Raw transfer]




GOL_E_14(3S1W)
TAL_THEAC
[Raw transfer]




E4P_B_7(3S1U)
TAL_THEAC
[Raw transfer]




I22_A_3(3TNO)
?
[Raw transfer]




I22_B_5(3TNO)
?
[Raw transfer]




F6R_A_3(3TE9)
?
[Raw transfer]




E4P_A_6(3S1U)
TAL_THEAC
[Raw transfer]




E4P_D_10(3S1U)
TAL_THEAC
[Raw transfer]




F6R_A_3(3TK7)
?
[Raw transfer]




A5P_A_4(3UPB)
?
[Raw transfer]




A5P_B_8(3UPB)
?
[Raw transfer]




F6R_B_4(3TK7)
?
[Raw transfer]




I22_A_3(3TKF)
?
[Raw transfer]




GOL_A_17(3CQ0)
TAL2_YEAST
[Raw transfer]




GOL_A_6(3S0C)
TAL_THEAC
[Raw transfer]




FLC_D_13(3S1W)
TAL_THEAC
[Raw transfer]




FLC_C_11(3S1W)
TAL_THEAC
[Raw transfer]




FLC_E_15(3S1W)
TAL_THEAC
[Raw transfer]




FLC_A_7(3S1W)
TAL_THEAC
[Raw transfer]




FLC_B_9(3S1W)
TAL_THEAC
[Raw transfer]




EDO_A_4(3CLM)
TAL_NEIG1
[Raw transfer]




EDO_A_4(3HJZ)
TAL_PROM9
[Raw transfer]




EDO_A_4(3HJZ)
TAL_PROM9
[Raw transfer]




87 HHSearch 94.6858%-115 - C3 -3R8R - TAL_BACSU -
56 PsiBlast_CBE 94.5458%-117 - C3 -3R8R - TAL_BACSU -
54 PsiBlast_CBE 94.4058%-121 - C3 -3R8R - TAL_BACSU -
2 PsiBlast_PDB 94.3858%-115 - C3 -3R8R - TAL_BACSU -
40 PsiBlast_CBE 93.7158%-115 - C3 -3R8R - TAL_BACSU -
30 PsiBlast_CBE 93.5456%-117 - C3 -1VPX - TAL_THEMA -
38 PsiBlast_CBE 92.6456%-115 - C3 -1VPX - TAL_THEMA -
26 PsiBlast_CBE 92.3856%-118 - C3 -1VPX - TAL_THEMA -
89 HHSearch 92.0753%-117 * C3 *1WX0 - TAL_THET8 -
7 PsiBlast_PDB 91.7651%-116 - C3 -1WX0 - TAL_THET8 -
66 PsiBlast_CBE 91.6250%-115 - C3 -3S1U 3.3 TAL_THEAC
86 HHSearch 90.6355%-122 - C3 -1VPX - TAL_THEMA -
65 PsiBlast_CBE 90.5550%-114 - C3 -3S1U 3.2 TAL_THEAC
55 PsiBlast_CBE 90.3158%-118 - C3 -3R8R - TAL_BACSU -
1 PsiBlast_PDB 90.3156%-124 - C3 -1VPX - TAL_THEMA -
39 PsiBlast_CBE 90.1556%-115 - C3 -1VPX - TAL_THEMA -
4 PsiBlast_PDB 90.0850%-115 - C3 -3S1U 3.5 TAL_THEAC
23 PsiBlast_CBE 89.5156%-121 - C3 -1VPX - TAL_THEMA -
69 PsiBlast_CBE 89.2350%-110 - C3 -3S1W 3.4 TAL_THEAC
70 PsiBlast_CBE 88.8450%-109 - C3 -3S1W 2.8 TAL_THEAC
3 PsiBlast_PDB 88.7850%-111 - C3 -3S0C 2.5 TAL_THEAC
64 PsiBlast_CBE 88.7550%-113 - C3 -3S1V 3.4 TAL_THEAC
61 PsiBlast_CBE 88.7350%-112 - C3 -3S1V 4.1 TAL_THEAC
63 PsiBlast_CBE 88.6450%-112 - C3 -3S1V 3.4 TAL_THEAC
58 PsiBlast_CBE 88.5350%-111 - C3 -3S1X 3.0 TAL_THEAC
71 PsiBlast_CBE 88.5150%-106 - C3 -3S1W 2.9 TAL_THEAC
88 HHSearch 88.4850%-110 - C3 -3S1X 3.5 TAL_THEAC
59 PsiBlast_CBE 88.3450%-112 - C3 -3S1X 2.9 TAL_THEAC
6 PsiBlast_PDB 88.1750%-110 - C3 -3S1X 3.5 TAL_THEAC
67 PsiBlast_CBE 88.1550%-110 - C3 -3S1U 3.9 TAL_THEAC
72 PsiBlast_CBE 88.0050%-111 - C3 -3S1W 2.9 TAL_THEAC
62 PsiBlast_CBE 87.9650%-112 - C3 -3S1V 3.5 TAL_THEAC
68 PsiBlast_CBE 87.7450%-112 - C3 -3S1U 3.8 TAL_THEAC
8 PsiBlast_PDB 87.7450%-109 - C3 -3S1W 3.9 TAL_THEAC
60 PsiBlast_CBE 87.6450%-110 - C3 -3S1X 4.2 TAL_THEAC
57 PsiBlast_CBE 87.2250%-112 - C3 -3S1X 4.0 TAL_THEAC
5 PsiBlast_PDB 86.9050%-111 - C3 -3S1V 3.6 TAL_THEAC
94 HHSearch 68.8134% -94 - C3 -3HJZ 3.5 TAL_PROM9
12 PsiBlast_PDB 67.3231%-117 - C3 -3TNO 2.5 ?
11 PsiBlast_PDB 67.3031%-116 - C3 -3TK7 2.9 ?
83 PsiBlast_CBE 66.9831%-116 - C3 -3UPB 4.0 ?
91 HHSearch 66.9430%-100 - C3 -3CQ0 2.1 TAL2_YEAST
13 PsiBlast_PDB 66.4831%-116 - C3 -3UPB 4.3 ?
96 HHSearch 65.3232% -89 - C3 -3TKF 6.0 ?
84 PsiBlast_CBE 65.1131%-111 - C3 -3TNO 3.8 ?
17 PsiBlast_PDB 64.4630%-114 - C3 -3TKF 4.4 ?
85 PsiBlast_CBE 64.4331%-112 - C3 -3TK7 2.7 ?
16 PsiBlast_PDB 64.0030%-113 - C3 -3TE9 4.5 ?
10 PsiBlast_PDB 63.9333%-105 - C3 -3HJZ 3.2 TAL_PROM9
92 HHSearch 53.8931% -83 - C3 -3CLM 3.3 TAL_NEIG1