@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0344: (2016-03-14 )
MTFKGFDKDFNITDKVAVVTGAASGIGKAMAELFSEKGAYVVLLDIKEDVKDVAAKINPSRTLALQVDITKKENIEKVVAEIKKVYPKIDILANSAGVALLEKAEDLPEEYWDKTMELNLKGSFLMAQIIGREMIATGGGKIVNMASQASVIALDKHVAYCASKAAIVSMTQVLAMEWAPYNINVNAISPTVILTELGKKAWAGQVGEDMKKLIPAGRFGYPEEVAACALFLVSDAASLITGENLIIDGGYTIK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_22(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_10(3RRO)
FABG_VIBCH
[Raw transfer]




EDO_A_11(3RRO)
FABG_VIBCH
[Raw transfer]




1 PsiBlast_PDB 94.6852%-100 - C2 -4NPC - ? -
21 PsiBlast_CBE 93.1652%-100 - C2 -4NPC - ? -
32 PsiBlast_CBE 86.3637% -99 - C2 -2WSB - ? -
30 PsiBlast_CBE 86.1437% -98 - C2 -3LQF - ? -
33 PsiBlast_CBE 85.9937%-100 - C2 -2WSB - ? -
10 PsiBlast_PDB 85.8937% -99 - C2 -3LQF - ? -
34 PsiBlast_CBE 85.7837% -99 - C2 -2WSB - ? -
35 PsiBlast_CBE 85.3837%-101 - C2 -2WDZ - ? -
36 PsiBlast_CBE 85.3537% -98 - C2 -2WDZ - ? -
37 PsiBlast_CBE 85.1437% -97 - C2 -2WDZ - ? -
57 PsiBlast_CBE 85.1134%-103 - C2 -2PNF - FABG_AQUAE -
11 PsiBlast_PDB 85.1037% -99 - C2 -2WSB - ? -
58 PsiBlast_CBE 84.7934%-100 - C2 -2PNF - FABG_AQUAE -
38 PsiBlast_CBE 84.6434%-104 - C2 -3D3W - DCXR_HUMAN -
18 PsiBlast_PDB 84.6034% -95 - C2 -3AWD - ? -
26 PsiBlast_CBE 84.3537%-101 - C2 -2D1Y - ? -
13 PsiBlast_PDB 84.0034%-107 - C2 -1PR9 - DCXR_HUMAN -
9 PsiBlast_PDB 83.2437% -99 - C2 -2WDZ - ? -
44 PsiBlast_CBE 83.2234% -96 - C2 -3AWD - ? -
29 PsiBlast_CBE 82.9137% -96 - C2 -3LQF - ? -
88 PsiBlast_CBE 78.2433% -95 - C2 -3RRO 3.0 FABG_VIBCH
87 PsiBlast_CBE 77.0833% -96 - C2 -3RRO 2.5 FABG_VIBCH