@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0355: (2016-03-14 )
MKKRLATTIIMLLSLALIIAGCGNNDTSKSDTAKTKEKEKTEVTSGASKTSYTDPSELKDKYDIVIVGAGGAGMSAALEAKAKGMNPVILEKMPLAGGNTMKASSGMNASETKFQKEEGINDSNDKFYEETLKGGHGTNDKAMLRFFVDNSASAIDWLDSMDIKLNNLTITGGMSEKRTHRPEDGSAVGKYLVDGLLKNVQEQKIPVFVNADVKEITQKDGKVTGVRVKLNNKDEKTISSDAVVVTTGGYGANKDMIEKERPDLKGYVTTNQEGSTGDGIKMIEKLGGTTVDMDQIQVHPTVQQDKSYLIGEAVRGEGAILVSQEGKRFGNELDTRDNVTASINKLPEKSAYLVFDSGVKDRVKAIAQYEEMGFVEEGKTIDELAGKINVPKEELTKTLDTWNASVKNKKDEAFGRTTAMDNDLSKAPYYAIKIGPGIHYTMGGVKINTNTEVLDKDGKPITGLFAAGEVTGGLHGENRIGGNSVAEIIIFGRQAGDKSAEFVKAQ

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_7(1QO8)
FRD2_SHEFN
[Raw transfer]




FAD_A_7(1QO8)
FRD2_SHEFN
[Raw transfer]




FAD_D_12(1QO8)
FRD2_SHEFN
[Raw transfer]




FAD_A_7(1Y0P)
FRDA_SHEFR
[Raw transfer]




FAD_A_13(1JRX)
FRDA_SHEFR
[Raw transfer]




FAD_B_14(1JRX)
FRDA_SHEFR
[Raw transfer]




FAD_B_14(1JRZ)
FRDA_SHEFR
[Raw transfer]




FAD_B_15(1M64)
FRDA_SHEFR
[Raw transfer]




FAD_B_14(1JRY)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(1Q9I)
FRDA_SHEFR
[Raw transfer]




FAD_A_9(1LJ1)
FRDA_SHEFR
[Raw transfer]




FAD_A_13(1JRX)
FRDA_SHEFR
[Raw transfer]




FAD_A_6(1E39)
FRDA_SHEFR
[Raw transfer]




FAD_B_15(1LJ1)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(1P2E)
FRDA_SHEFR
[Raw transfer]




FAD_A_13(1JRY)
FRDA_SHEFR
[Raw transfer]




FAD_A_6(1QJD)
FRDA_SHEFR
[Raw transfer]




FAD_A_9(1M64)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(2B7S)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(1P2H)
FRDA_SHEFR
[Raw transfer]




FAD_A_13(1JRZ)
FRDA_SHEFR
[Raw transfer]




FAD_A_9(1KSU)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(1Y0P)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(2B7R)
FRDA_SHEFR
[Raw transfer]




FAD_A_7(1KSS)
FRDA_SHEFR
[Raw transfer]




FAD_B_15(1KSU)
FRDA_SHEFR
[Raw transfer]




24 PsiBlast_CBE 85.4144% -48 - C5 -1D4C - FRDA_SHEON -
22 PsiBlast_CBE 85.1644% -49 - C5 -1D4C - FRDA_SHEON -
23 PsiBlast_CBE 84.2144% -46 - C5 -1D4C - FRDA_SHEON -
79 HHSearch 84.0940% -48 - C4 -1QO8 12.0 FRD2_SHEFN
2 PsiBlast_PDB 83.9944% -44 - C4 -1D4C - FRDA_SHEON -
1 PsiBlast_PDB 83.9341% -45 - C4 -1QO8 12.0 FRD2_SHEFN
99 Fugue 83.8636% -32 - C4 -1JRX 13.5 FRDA_SHEFR
100 Fugue 83.5637% -39 - C4 -1QJD - FRDA_SHEFR -
78 HHSearch 82.8140% -44 * C4 *1Y0P 14.0 FRDA_SHEFR
21 PsiBlast_CBE 82.1741% -45 - C4 -1QO8 12.2 FRD2_SHEFN
27 PsiBlast_CBE 80.1739% -36 - C4 -1JRX 12.7 FRDA_SHEFR
14 PsiBlast_PDB 79.8539% -40 - C4 -1JRZ 13.0 FRDA_SHEFR
17 PsiBlast_PDB 79.7539% -40 - C4 -1LJ1 13.1 FRDA_SHEFR
7 PsiBlast_PDB 79.5540% -39 - C4 -1Y0P 13.2 FRDA_SHEFR
30 PsiBlast_CBE 79.2539% -38 - C4 -1LJ1 13.1 FRDA_SHEFR
28 PsiBlast_CBE 79.1739% -38 - C4 -1JRZ 12.6 FRDA_SHEFR
6 PsiBlast_PDB 79.0540% -38 - C4 -1QJD 12.8 FRDA_SHEFR
25 PsiBlast_CBE 78.9840% -39 - C4 -1KSU 12.8 FRDA_SHEFR
13 PsiBlast_PDB 78.9139% -36 - C4 -1JRX 12.7 FRDA_SHEFR
3 PsiBlast_PDB 78.8040% -38 - C4 -1KSU 13.1 FRDA_SHEFR
8 PsiBlast_PDB 78.7040% -40 - C4 -1Q9I 13.6 FRDA_SHEFR
9 PsiBlast_PDB 78.5439% -41 - C4 -2B7R 13.0 FRDA_SHEFR
29 PsiBlast_CBE 78.5239% -41 - C4 -1M64 13.3 FRDA_SHEFR
15 PsiBlast_PDB 78.4339% -41 - C4 -1M64 13.3 FRDA_SHEFR
10 PsiBlast_PDB 78.4240% -38 - C4 -1KSS 13.1 FRDA_SHEFR
4 PsiBlast_PDB 78.1840% -38 - C4 -1P2H 13.2 FRDA_SHEFR
16 PsiBlast_PDB 77.9839% -39 - C4 -1E39 13.0 FRDA_SHEFR
5 PsiBlast_PDB 77.9240% -36 - C4 -1P2E 12.2 FRDA_SHEFR
26 PsiBlast_CBE 77.9139% -39 - C4 -1JRY 12.5 FRDA_SHEFR
12 PsiBlast_PDB 77.5939% -38 - C4 -2B7S 12.8 FRDA_SHEFR
11 PsiBlast_PDB 77.4539% -39 - C4 -1JRY 12.6 FRDA_SHEFR