@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0390: (2016-03-15 )
MVKTWEEFLKQEAKQPYFIELMEAVKDARAKGNVYPSEEDMFSCFRLCPYNQVKVVILGQDPYHGPGQAHGLSFSVQKDVRIPPSLRNIYKELKTDLDIEPADHGYLAKWAEQGVLLMNTSWSVEEGKAGSHKKLGWATFTDHVLEELNNYDKPLVFILWGNHAIKAASGITNPQHLIIKGVHPSPLAASRGFFGSKPFSKTNAFLEEHERKPIDWDLNEQ

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FCF_A_2(3FCF)
UNG_HUMAN
[Raw transfer]




302_B_2(2HXM)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




3FI_A_2(3FCI)
UNG_HUMAN
[Raw transfer]




5NU_A_2(4WS5)
?
[Raw transfer]




URA_B_2(5EUG)
UNG_ECOLI
[Raw transfer]




3FL_B_8(3FCL)
UNG_HUMAN
[Raw transfer]




URA_B_2(2EUG)
UNG_ECOLI
[Raw transfer]




3FL_A_3(3FCL)
UNG_HUMAN
[Raw transfer]




URA_A_2(4WPL)
?
[Raw transfer]




GOL_A_3(1OKB)
?
[Raw transfer]




URA_A_2(4WRU)
?
[Raw transfer]




GOL_B_5(1OKB)
?
[Raw transfer]




GOL_B_2(3EUG)
UNG_ECOLI
[Raw transfer]




5NU_A_4(4WS4)
?
[Raw transfer]




URF_A_2(4WS0)
?
[Raw transfer]




GOL_A_8(4WRW)
?
[Raw transfer]




6UA_A_4(4WS2)
?
[Raw transfer]




URF_A_2(4WS1)
?
[Raw transfer]




URA_D_4(1UDH)
UNG_HHV11
[Raw transfer]




DUR_A_2(2C53)
UNG_HHV11
[Raw transfer]




URA_A_2(4WRV)
?
[Raw transfer]




6UA_A_2(4WS3)
?
[Raw transfer]




5UC_A_2(4WS7)
?
[Raw transfer]




URA_B_2(1FLZ)
UNG_ECOLI
[Raw transfer]




FCK_B_2(3FCK)
UNG_HUMAN
[Raw transfer]




URB_A_3(3CXM)
?
[Raw transfer]




URB_A_3(3CXM)
?
[Raw transfer]




TUL_A_2(4WS8)
?
[Raw transfer]




NACID_C_3(4UQM)
?
[Raw transfer]

-

CIT_A_2(4WRY)
?
[Raw transfer]




CIT_A_2(4WPK)
?
[Raw transfer]




CIT_A_3(4WS4)
?
[Raw transfer]




SUC_A_2(2C56)
UNG_HHV11
[Raw transfer]




CIT_A_4(4WS6)
?
[Raw transfer]




FLC_A_2(3A7N)
UNG_MYCTU
[Raw transfer]




CIT_A_3(4WS2)
?
[Raw transfer]




NACID_D_1(1LAU)
UNG_HHV11
[Raw transfer]

-

CIT_A_2(4WRZ)
?
[Raw transfer]




NACID_C_2(2OXM)
UNG_HUMAN
[Raw transfer]

-

NACID_A_1(2SSP)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1EMH)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1EMJ)
UNG_HUMAN
[Raw transfer]

-

NACID_B_2(4SKN)
UNG_HUMAN
[Raw transfer]

-

NACID_A_1(1SSP)
UNG_HUMAN
[Raw transfer]

-

CHAIN_C_2(2OYT)
UNG_HUMAN
[Raw transfer]

-

NACID_C_2(1Q3F)
UNG_HUMAN
[Raw transfer]

-

IMD_A_3(3TKB)
UNG_HUMAN
[Raw transfer]




NACID_B_2(1SSP)
UNG_HUMAN
[Raw transfer]

-

URE_D_6(2J8X)
UNG_EBVB9
[Raw transfer]




CHAIN_C_3(3UF7)
UNG_ECOLI
[Raw transfer]

-

CHAIN_C_3(3UF7)
UNG_ECOLI
[Raw transfer]

-

URE_B_5(2J8X)
UNG_EBVB9
[Raw transfer]




URE_B_5(2J8X)
UNG_EBVB9
[Raw transfer]




37 PsiBlast_CBE 96.9150% -93 - C8 -1OKB 3.2 ?
12 PsiBlast_PDB 96.9049%-107 - C8 -4EUG - UNG_ECOLI -
19 PsiBlast_PDB 96.4949%-100 - C8 -2JHQ - UNG_VIBCH -
4 PsiBlast_PDB 96.3650%-102 - C8 -1EUG - UNG_ECOLI -
13 PsiBlast_PDB 96.2849%-104 - C8 -5EUG 3.3 UNG_ECOLI
36 PsiBlast_CBE 96.1750% -93 - C8 -1OKB 3.1 ?
14 PsiBlast_PDB 96.0049%-107 - C8 -3UF7 5.1 UNG_ECOLI
8 PsiBlast_PDB 95.9649%-104 - C8 -1UUG - UNG_ECOLI -
3 PsiBlast_PDB 95.7048%-103 - C8 -3ZOR - UNG_BACSU -
22 PsiBlast_CBE 95.5550% -98 - C8 -3FCL 5.8 UNG_HUMAN
6 PsiBlast_PDB 95.5049%-104 - C8 -3EUG 2.6 UNG_ECOLI
5 PsiBlast_PDB 95.3649%-104 - C8 -2EUG 3.3 UNG_ECOLI
24 PsiBlast_CBE 95.3050% -99 - C8 -3FCI 6.1 UNG_HUMAN
2 PsiBlast_PDB 95.2348%-105 - C8 -3ZOQ - UNG_BACSU -
23 PsiBlast_CBE 95.1150%-100 - C8 -3FCK 6.0 UNG_HUMAN
21 PsiBlast_CBE 94.9650% -99 - C8 -3FCL 5.9 UNG_HUMAN
25 PsiBlast_CBE 94.9550% -97 - C8 -3FCF 7.0 UNG_HUMAN
16 PsiBlast_PDB 94.8749%-101 - C8 -2UUG - UNG_ECOLI -
38 PsiBlast_CBE 94.8644%-101 - C8 -3CXM 3.3 ?
11 PsiBlast_PDB 94.8349%-103 - C8 -1LQM - UNG_ECOLI -
77 HHSearch 94.7550% -96 * C8 *3FCI 6.1 UNG_HUMAN
28 PsiBlast_CBE 94.7450% -97 - C8 -2HXM 7.2 UNG_HUMAN
34 PsiBlast_CBE 94.6150% -93 - C8 -2SSP 6.7 UNG_HUMAN
32 PsiBlast_CBE 94.4950% -97 - C8 -1EMH 3.8 UNG_HUMAN
33 PsiBlast_CBE 94.4850% -95 - C8 -3TKB 2.7 UNG_HUMAN
29 PsiBlast_CBE 94.4750% -94 - C8 -1SSP 8.0 UNG_HUMAN
26 PsiBlast_CBE 93.9450% -93 - C8 -2OYT 1.6 UNG_HUMAN
31 PsiBlast_CBE 93.9250% -95 - C8 -1EMJ 3.9 UNG_HUMAN
35 PsiBlast_CBE 93.7549% -95 - C8 -4SKN 3.5 UNG_HUMAN
30 PsiBlast_CBE 93.6750% -96 - C8 -1Q3F 3.8 UNG_HUMAN
78 HHSearch 93.4648% -97 - C8 -3UF7 5.1 UNG_ECOLI
27 PsiBlast_CBE 93.3450% -95 - C8 -2OXM 1.6 UNG_HUMAN
7 PsiBlast_PDB 93.1349%-101 - C8 -1FLZ 3.6 UNG_ECOLI
39 PsiBlast_CBE 92.7945%-100 - C8 -2J8X 2.7 UNG_EBVB9
82 HHSearch 92.5547% -94 - C8 -2J8X 2.6 UNG_EBVB9
40 PsiBlast_CBE 92.3345% -94 - C8 -2J8X 2.6 UNG_EBVB9
20 PsiBlast_PDB 92.1750% -88 - C8 -4UQM 3.9 ?
79 HHSearch 91.5743% -89 - C8 -3CXM 3.3 ?
46 PsiBlast_CBE 91.0940% -98 - C8 -2C56 3.0 UNG_HHV11
47 PsiBlast_CBE 90.6240%-100 - C8 -2C53 4.0 UNG_HHV11
43 PsiBlast_CBE 90.3341% -99 - C8 -1UDH 3.5 UNG_HHV11
45 PsiBlast_CBE 89.7241%-100 - C8 -1LAU 5.8 UNG_HHV11
65 PsiBlast_CBE 88.1539% -97 - C8 -3A7N 2.4 UNG_MYCTU
63 PsiBlast_CBE 87.7039% -95 - C8 -4WPL 3.3 ?
49 PsiBlast_CBE 87.5339% -92 - C8 -4WS7 3.3 ?
51 PsiBlast_CBE 87.4439%-101 - C8 -4WS5 3.9 ?
64 PsiBlast_CBE 87.3139% -92 - C8 -4WPK 2.4 ?
50 PsiBlast_CBE 87.1439% -92 - C8 -4WS6 1.8 ?
58 PsiBlast_CBE 87.0039% -92 - C8 -4WRY 3.5 ?
55 PsiBlast_CBE 86.8539% -92 - C8 -4WS1 3.2 ?
56 PsiBlast_CBE 86.8339% -91 - C8 -4WS0 2.6 ?
57 PsiBlast_CBE 86.7939% -94 - C8 -4WRZ 2.3 ?
52 PsiBlast_CBE 86.7639% -92 - C8 -4WS4 3.9 ?
54 PsiBlast_CBE 86.7439% -91 - C8 -4WS2 3.7 ?
62 PsiBlast_CBE 86.5939% -94 - C8 -4WRU 3.4 ?
48 PsiBlast_CBE 86.3739% -92 - C8 -4WS8 3.1 ?
60 PsiBlast_CBE 85.4639% -87 - C8 -4WRW 2.5 ?
53 PsiBlast_CBE 85.2039% -88 - C8 -4WS3 3.6 ?
61 PsiBlast_CBE 84.9739% -88 - C8 -4WRV 3.4 ?