@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0490: (2016-03-16 )
MTNKITERITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDDGVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEILF

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_D_13(3TNL)
AROE_LISMO
[Raw transfer]




NAD_B_8(3TNL)
AROE_LISMO
[Raw transfer]




NAP_A_6(2O7S)
DHQSD_ARATH
[Raw transfer]




NAP_B_7(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_C_9(2HK9)
AROE_AQUAE
[Raw transfer]




NAD_C_10(3TNL)
AROE_LISMO
[Raw transfer]




NAP_D_11(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




NAD_A_5(3TNL)
AROE_LISMO
[Raw transfer]




NAD_A_5(3TNL)
AROE_LISMO
[Raw transfer]




NAD_B_5(3T4E)
YDIB_SALTY
[Raw transfer]




NAD_A_3(3T4E)
YDIB_SALTY
[Raw transfer]




NAD_A_3(3T4E)
YDIB_SALTY
[Raw transfer]




NAD_A_5(1VI2)
YDIB_ECOLI
[Raw transfer]




NAD_A_3(1NPD)
YDIB_ECOLI
[Raw transfer]




DHK_A_6(2O7Q)
DHQSD_ARATH
[Raw transfer]




NAP_B_6(1NVT)
AROE_METJA
[Raw transfer]




NAD_A_3(1O9B)
YDIB_ECOLI
[Raw transfer]




SKM_A_2(3DOO)
AROE_STAEQ
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




SKM_A_6(2HK9)
AROE_AQUAE
[Raw transfer]




NAP_A_5(1NVT)
AROE_METJA
[Raw transfer]




SKM_A_6(2HK9)
AROE_AQUAE
[Raw transfer]




DHK_A_5(2O7S)
DHQSD_ARATH
[Raw transfer]




SKM_B_8(2D5C)
AROE_THET8
[Raw transfer]




SKM_A_5(2EV9)
AROE_THET8
[Raw transfer]




SKM_B_6(2EV9)
AROE_THET8
[Raw transfer]




SKM_A_7(2D5C)
AROE_THET8
[Raw transfer]




DTV_A_20(1NYT)
AROE_ECOLI
[Raw transfer]




30 PsiBlast_CBE 99.23100%-112 - C6 -3TNL 9.8 AROE_LISMO
1 PsiBlast_PDB 98.79100%-114 - C6 -3TOZ - AROE_LISMO -
28 PsiBlast_CBE 98.78100%-114 - C6 -3TNL 9.9 AROE_LISMO
58 HHSearch 98.63100%-116 - C6 -3TNL 9.5 AROE_LISMO
2 PsiBlast_PDB 98.63100%-116 - C6 -3TNL 9.5 AROE_LISMO
25 PsiBlast_CBE 98.21100%-117 - C6 -3TOZ - AROE_LISMO -
22 PsiBlast_CBE 98.18100%-113 - C6 -3TOZ - AROE_LISMO -
29 PsiBlast_CBE 98.16100%-113 - C6 -3TNL 9.4 AROE_LISMO
27 PsiBlast_CBE 98.12100%-114 - C6 -3TOZ - AROE_LISMO -
21 PsiBlast_CBE 97.93100%-112 - C6 -3TOZ - AROE_LISMO -
24 PsiBlast_CBE 97.88100%-113 - C6 -3TOZ - AROE_LISMO -
26 PsiBlast_CBE 97.86100%-114 - C6 -3TOZ - AROE_LISMO -
23 PsiBlast_CBE 97.80100%-112 - C6 -3TOZ - AROE_LISMO -
31 PsiBlast_CBE 84.8351%-104 - C6 -3T4E 9.8 YDIB_SALTY
59 HHSearch 84.2151%-103 - C6 -3T4E 9.6 YDIB_SALTY
3 PsiBlast_PDB 84.2151%-103 - C6 -3T4E 9.6 YDIB_SALTY
4 PsiBlast_PDB 82.7347%-108 - C6 -1VI2 9.1 YDIB_ECOLI
5 PsiBlast_PDB 82.1847% -97 - C6 -1NPD 8.9 YDIB_ECOLI
6 PsiBlast_PDB 81.3647%-106 - C6 -1O9B 7.9 YDIB_ECOLI
8 PsiBlast_PDB 73.4837% -85 - C6 -2EGG - AROE_GEOKA -
61 HHSearch 71.8040% -89 - C6 -1NVT 7.9 AROE_METJA
73 HHSearch 71.7135% -91 - C6 -2HK9 3.9 AROE_AQUAE
69 HHSearch 71.5633% -92 - C6 -2O7S 9.2 DHQSD_ARATH
20 PsiBlast_PDB 71.2430% -93 - C6 -2O7Q 3.4 DHQSD_ARATH
13 PsiBlast_PDB 70.6434% -91 - C6 -3DOO 2.7 AROE_STAEQ
11 PsiBlast_PDB 69.7535% -92 - C6 -2HK9 3.9 AROE_AQUAE
63 HHSearch 69.7132% -84 * C6 *2D5C 3.5 AROE_THET8
35 PsiBlast_CBE 69.5635% -86 - C6 -2HK9 8.9 AROE_AQUAE
33 PsiBlast_CBE 69.5435% -86 - C6 -2HK9 10.4 AROE_AQUAE
34 PsiBlast_CBE 69.3035% -84 - C6 -2HK9 9.4 AROE_AQUAE
7 PsiBlast_PDB 68.5739% -82 - C6 -1NVT 6.9 AROE_METJA
32 PsiBlast_CBE 67.2939% -79 - C6 -1NVT 5.8 AROE_METJA
18 PsiBlast_PDB 64.7431% -88 - C6 -2D5C 3.4 AROE_THET8
41 PsiBlast_CBE 64.6531% -91 - C6 -2D5C 3.2 AROE_THET8
40 PsiBlast_CBE 64.0831% -87 - C6 -2EV9 3.5 AROE_THET8
19 PsiBlast_PDB 64.0031% -87 - C6 -2EV9 3.7 AROE_THET8