@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0491: (2016-03-16 )
MNKVVVKNVTFGEGAPKICVPMVGKTVAALKEEAEMLQTIDLDVVEWRVDFFEDVKDLAKVEAALGEIRAILPETPILFTFRSAKEGGELAVSDEFYFELNETLAGTGKIDLVDVELFNEEADVLRLIETAHKNNVKVVMSNHDFDKTPAKEEIVSRLTRMEALGADLPKIAVMPKSAGDVLTLLDATNTVFEKANQPIITMSMAGTGVISRLAGEVFGSAMTFGAAKKASAPGQIDVNELRHVLDLLHKQF

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DQA_B_4(3NNT)
AROD_SALTY
[Raw transfer]




CIT_B_8(4CNN)
AROD_SALTI
[Raw transfer]




CIT_A_3(3LB0)
AROD_SALTY
[Raw transfer]




9C4_A_3(4CNP)
AROD_SALTI
[Raw transfer]




DQA_A_3(3NNT)
AROD_SALTY
[Raw transfer]




QIC_A_3(4GUI)
AROD_SALTY
[Raw transfer]




QIC_B_4(4IUO)
AROD_SALTY
[Raw transfer]




9C4_B_8(4CNP)
AROD_SALTI
[Raw transfer]




SKM_A_3(4GUJ)
AROD_SALTY
[Raw transfer]




QIC_A_3(4IUO)
AROD_SALTY
[Raw transfer]




SKM_B_7(4GUJ)
AROD_SALTY
[Raw transfer]




QIC_B_6(4GUI)
AROD_SALTY
[Raw transfer]




3DS_A_4(4GUG)
AROD_SALTY
[Raw transfer]




9PY_B_6(4CNO)
AROD_SALTI
[Raw transfer]




VAU_A_2(4UIO)
?
[Raw transfer]




9PY_A_5(4CNO)
AROD_SALTI
[Raw transfer]




DHS_F_6(1L9W)
AROD_SALTI
[Raw transfer]




9PY_D_8(4CNO)
AROD_SALTI
[Raw transfer]




DHS_E_5(1L9W)
AROD_SALTI
[Raw transfer]




DHS_G_7(1L9W)
AROD_SALTI
[Raw transfer]




DHS_A_5(3JS3)
AROD_PEPD6
[Raw transfer]




DHS_C_7(3JS3)
AROD_PEPD6
[Raw transfer]




DHS_H_8(1L9W)
AROD_SALTI
[Raw transfer]




DHS_A_3(1QFE)
AROD_SALTI
[Raw transfer]




DHS_B_6(3JS3)
AROD_PEPD6
[Raw transfer]




WPL_B_7(4CLM)
AROD_SALTI
[Raw transfer]




DHS_D_8(3JS3)
AROD_PEPD6
[Raw transfer]




3DS_A_3(4GUH)
AROD_SALTY
[Raw transfer]




DHS_A_3(1QFE)
AROD_SALTI
[Raw transfer]




DHS_B_4(1QFE)
AROD_SALTI
[Raw transfer]




3DS_B_5(4GUG)
AROD_SALTY
[Raw transfer]




3DS_B_5(4GUH)
AROD_SALTY
[Raw transfer]




9PY_C_7(4CNO)
AROD_SALTI
[Raw transfer]




SHL_D_13(4H3D)
AROD_PEPD6
[Raw transfer]




SHL_A_7(4H3D)
AROD_PEPD6
[Raw transfer]




MLA_B_3(3S42)
AROD_SALTY
[Raw transfer]




SHL_B_9(4H3D)
AROD_PEPD6
[Raw transfer]




SHL_C_12(4H3D)
AROD_PEPD6
[Raw transfer]




DHK_B_4(1SFJ)
AROD_STAAR
[Raw transfer]




DHK_A_3(1SFJ)
AROD_STAAR
[Raw transfer]




SIN_B_9(4GFS)
AROD_SALTY
[Raw transfer]




PEG_A_6(4H3D)
AROD_PEPD6
[Raw transfer]




21 PsiBlast_CBE 98.1158%-104 - C6 -4H3D 2.8 AROD_PEPD6
23 PsiBlast_CBE 97.5358%-103 - C6 -4H3D 2.9 AROD_PEPD6
1 PsiBlast_PDB 97.4458%-101 - C6 -3JS3 4.4 AROD_PEPD6
2 PsiBlast_PDB 97.4158%-102 - C6 -4H3D 3.2 AROD_PEPD6
25 PsiBlast_CBE 97.2458%-102 - C6 -3JS3 5.0 AROD_PEPD6
24 PsiBlast_CBE 97.1958%-100 - C6 -3JS3 4.0 AROD_PEPD6
22 PsiBlast_CBE 97.1558%-102 - C6 -4H3D 3.1 AROD_PEPD6
29 PsiBlast_CBE 95.8256%-101 - C6 -4GFS 3.6 AROD_SALTY
43 PsiBlast_CBE 95.7855% -97 - C6 -1QFE 4.6 AROD_SALTI
26 PsiBlast_CBE 95.6558% -98 - C6 -3JS3 3.4 AROD_PEPD6
45 PsiBlast_CBE 95.5455% -92 - C6 -1L9W 3.8 AROD_SALTI
37 PsiBlast_CBE 95.4756% -96 - C6 -3M7W - AROD_SALTY -
85 Fugue 95.4654% -97 * C6 *1QFE 4.5 AROD_SALTI
14 PsiBlast_PDB 95.2755% -97 - C6 -1QFE 4.5 AROD_SALTI
44 PsiBlast_CBE 95.1655% -93 - C6 -1L9W 4.1 AROD_SALTI
32 PsiBlast_CBE 95.1456% -98 - C6 -3OEX - AROD_SALTY -
15 PsiBlast_PDB 95.1255% -95 - C6 -1L9W 4.3 AROD_SALTI
17 PsiBlast_PDB 95.0455% -96 - C6 -3NNT 5.2 AROD_SALTY
31 PsiBlast_CBE 95.0056% -97 - C6 -3OEX - AROD_SALTY -
35 PsiBlast_CBE 94.8956% -97 - C6 -3M7W - AROD_SALTY -
6 PsiBlast_PDB 94.7056% -98 - C6 -4GUI 5.2 AROD_SALTY
51 PsiBlast_CBE 94.6854% -98 - C6 -4CNP 3.9 AROD_SALTI
46 PsiBlast_CBE 94.6355% -97 - C6 -1L9W 4.0 AROD_SALTI
52 PsiBlast_CBE 94.4854% -96 - C6 -4CNP 4.0 AROD_SALTI
7 PsiBlast_PDB 94.4356% -96 - C6 -4GUJ 5.5 AROD_SALTY
50 PsiBlast_CBE 94.2954% -97 - C6 -4UIO 4.3 ?
20 PsiBlast_PDB 94.2854% -98 - C6 -4CNO 4.0 AROD_SALTI
58 PsiBlast_CBE 94.1454% -97 - C6 -4CLM 3.6 AROD_SALTI
27 PsiBlast_CBE 94.0856% -98 - C6 -4GUJ 3.5 AROD_SALTY
55 PsiBlast_CBE 93.6754% -99 - C6 -4CNO 3.6 AROD_SALTI
9 PsiBlast_PDB 93.6556% -95 - C6 -3LB0 3.9 AROD_SALTY
56 PsiBlast_CBE 93.6454%-100 - C6 -4CNN 4.6 AROD_SALTI
54 PsiBlast_CBE 93.6454% -98 - C6 -4CNO 3.2 AROD_SALTI
28 PsiBlast_CBE 93.6356% -94 - C6 -4GUI 3.9 AROD_SALTY
48 PsiBlast_CBE 93.6255% -98 - C6 -3NNT 5.3 AROD_SALTY
38 PsiBlast_CBE 93.4756% -96 - C6 -3S42 2.8 AROD_SALTY
13 PsiBlast_PDB 93.3655% -97 - C6 -4GUH 4.5 AROD_SALTY
53 PsiBlast_CBE 93.2254% -94 - C6 -4CNO 4.1 AROD_SALTI
40 PsiBlast_CBE 92.7355% -93 - C6 -4GUH 4.6 AROD_SALTY
47 PsiBlast_CBE 92.5255% -95 - C6 -4IUO 5.1 AROD_SALTY
12 PsiBlast_PDB 92.4955%-101 - C6 -4GUG 3.0 AROD_SALTY
18 PsiBlast_PDB 92.4555% -94 - C6 -4IUO 4.6 AROD_SALTY
41 PsiBlast_CBE 91.5055%-103 - C6 -4GUG 4.4 AROD_SALTY
61 PsiBlast_CBE 76.8131% -83 - C6 -1SFJ 3.5 AROD_STAAR
60 PsiBlast_CBE 76.5231% -85 - C6 -1SFJ 3.4 AROD_STAAR