@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0505: (2016-03-16 )
VAKIVPSVFGADIGRINEQLQVLEKNDIDLLHVDMMDGSFVPNIAFGPDQIKMMKKGTKLQFDVHMMVYEPDRYIPRLVEAGAHMITVHQEATTHLHRTIQLIKSYGVRAGVVLNPGTPPSTLEYVLDDIDCILLMTVNPGLGGQKFFQSSLEKIRKTKAYIGNRPIQIEVDGGVNDELAKECTLAGADLIVVGSYLFEGDIEANLEKLAKGVLTE

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5SP_A_4(3OVR)
RPE_HUMAN
[Raw transfer]




5RP_A_4(3OVQ)
RPE_HUMAN
[Raw transfer]




5SP_B_10(3OVR)
RPE_HUMAN
[Raw transfer]




5RP_B_10(3OVQ)
RPE_HUMAN
[Raw transfer]




GOL_A_6(3QC3)
RPE_HUMAN
[Raw transfer]




54 HHSearch 97.9044%-134 - C2 -2FLI - ? -
74 Fugue 95.0943%-130 - C2 -1RPX - RPE_SOLTU -
29 PsiBlast_CBE 94.9946%-137 - C2 -2FLI - ? -
24 PsiBlast_CBE 94.6146%-139 - C2 -2FLI - ? -
71 HHSearch 94.5442%-132 - C2 -1RPX - RPE_SOLTU -
1 PsiBlast_PDB 93.7846%-138 - C2 -2FLI - ? -
31 PsiBlast_CBE 93.7546%-137 - C2 -2FLI - ? -
2 PsiBlast_PDB 93.7548%-142 - C2 -1RPX - RPE_SOLTU -
27 PsiBlast_CBE 93.6646%-137 - C2 -2FLI - ? -
30 PsiBlast_CBE 93.6146%-137 - C2 -2FLI - ? -
25 PsiBlast_CBE 93.4246%-135 - C2 -2FLI - ? -
26 PsiBlast_CBE 93.4146%-137 - C2 -2FLI - ? -
22 PsiBlast_CBE 93.1446%-137 - C2 -2FLI - ? -
28 PsiBlast_CBE 93.1046%-136 - C2 -2FLI - ? -
23 PsiBlast_CBE 93.0346%-133 - C2 -2FLI - ? -
21 PsiBlast_CBE 93.0246%-136 - C2 -2FLI - ? -
33 PsiBlast_CBE 92.5048%-142 - C2 -1RPX - RPE_SOLTU -
32 PsiBlast_CBE 92.4148%-142 - C2 -1RPX - RPE_SOLTU -
66 HHSearch 90.0037%-124 * C2 *1H1Y - RPE1_ORYSJ -
67 HHSearch 89.9940%-131 - C2 -1TQJ - RPE_SYNY3 -
38 PsiBlast_CBE 88.2235%-122 - C2 -3OVQ 3.6 RPE_HUMAN
37 PsiBlast_CBE 87.7635%-119 - C2 -3OVR 4.2 RPE_HUMAN
8 PsiBlast_PDB 87.6535%-121 - C2 -3OVR 4.4 RPE_HUMAN
14 PsiBlast_PDB 87.2133%-124 - C2 -3QC3 2.4 RPE_HUMAN
7 PsiBlast_PDB 87.1735%-120 - C2 -3OVQ 4.1 RPE_HUMAN