@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0608: (2016-03-17 )
MSGPGPGGGMRMQTAAKPKNFKQTLFRLLGYMKPRSVAIIVVFIFAILSTIFNIFSPKELGKATTEIFKGVMSQDGINNDKIFNILMIVLVLYLGSSLFSFIQQYVMSSVAQRTVYDMRKDLKAKMARLPLKYYDTRSNGDILSRSVNDMDNIANTLQQSLTQAITAIVQMIGVLIMMLTISWQMTLIVLVTVPISIILVAIIAGRSQRYFGAQQRNLGILNDTVEETYGGQTIIKAFGQEKKTLVKFDEVNEDYFKAAKKAQFISGIMMPVMQFVGNLGYVGVCVAGGIFVTNGTLQVGDIQSFTQYVQLFTQPISSVANIANIIQSTIASAERVFEMMDEEEEKDEIPANVNQVAGEEHSIVFDHVKFGYTPDKPLMTDLNIHVEEGQMVAIVGPTGAGKTTIINLLMRFYDVDGGQIRMKGIDTRDMTKDAVREKFGMVLQDTWLFNGTIADNIAYGREGATKDEVIGAAKAAYADDFIRRLPNGYDTILNEEGSNISQGQKQLLTIARAILSDPSILILDEATSSVDTRTELNIQLAMGNLMEGRTSFVIAHRLSTIRDADLILVMNHGSVIEQGTHQELLDAKGFYADLYNSQFTGAQAV

Atome Classification :

(46 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_7(2ONJ)
Y1866_STAAM
[Raw transfer]




ANP_A_8(2ONJ)
Y1866_STAAM
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ATP_D_12(1XEF)

[Raw transfer]




ADP_A_5(2HYD)
Y1866_STAAM
[Raw transfer]




ATP_B_10(1XEF)
HLYBP_ECOLX
[Raw transfer]




ADP_A_3(3NHA)

[Raw transfer]




ATP_C_11(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_B_8(2IXF)
TAP1_RAT
[Raw transfer]




ADP_A_2(3NHB)

[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_5(2IXF)
TAP1_RAT
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ADP_B_6(2HYD)
Y1866_STAAM
[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_7(1MV5)
LMRA_LACLA
[Raw transfer]




ATP_A_7(1MV5)
LMRA_LACLA
[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_2(3NH9)

[Raw transfer]




ACP_A_4(4AYX)
ABCBA_HUMAN
[Raw transfer]




ADP_A_2(5DGX)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ANP_A_2(4AYW)
ABCBA_HUMAN
[Raw transfer]




4 PsiBlast_PDB 89.4044%-110 - C1 -4Q4J - Y288_THEMA -
1 PsiBlast_PDB 89.0544%-109 - C1 -3QF4 - Y288_THEMA -
2 PsiBlast_PDB 88.8144%-111 - C1 -4Q4A - Y288_THEMA -
3 PsiBlast_PDB 88.2644%-106 - C1 -4Q4H - Y288_THEMA -
122 Fugue 74.6334% -96 - C1 -3B60 - MSBA_SALTY -
102 HHSearch 74.5434% -97 - C1 -3B60 - MSBA_SALTY -
8 PsiBlast_PDB 74.1433%-100 - C1 -3B60 - MSBA_SALTY -
23 PsiBlast_CBE 73.8833%-100 - C1 -3B60 - MSBA_SALTY -
22 PsiBlast_CBE 73.7533%-100 - C1 -3B60 - MSBA_SALTY -
21 PsiBlast_CBE 73.6933%-100 - C1 -3B60 - MSBA_SALTY -
9 PsiBlast_PDB 73.5333%-100 - C1 -2HYD 5.9 Y1866_STAAM
10 PsiBlast_PDB 73.2533%-101 - C1 -2ONJ 6.0 Y1866_STAAM
31 PsiBlast_CBE 73.2433%-101 - C1 -2HYD 6.1 Y1866_STAAM
30 PsiBlast_CBE 72.8133%-102 - C1 -2ONJ 6.2 Y1866_STAAM
19 PsiBlast_PDB 72.7231% -99 * C1 *4F4C - PGP1_CAEEL -
15 PsiBlast_PDB 72.6530%-101 - C1 -4AYX 5.4 ABCBA_HUMAN
16 PsiBlast_PDB 72.3030% -99 - C1 -3ZDQ - ABCBA_HUMAN -
104 HHSearch 70.7128% -98 - C1 -3WMG - ? -
14 PsiBlast_PDB 70.1830% -97 - C1 -4AYT - ABCBA_HUMAN -
103 HHSearch 69.7529% -94 - C1 -3ZDQ - ABCBA_HUMAN -
13 PsiBlast_PDB 67.8730% -96 - C1 -4AYW 5.1 ABCBA_HUMAN
59 PsiBlast_CBE 56.5142%-116 - C1 -1XEF 6.2 HLYBP_ECOLX
57 PsiBlast_CBE 56.4942%-119 - C1 -1XEF 6.5 HLYBP_ECOLX
58 PsiBlast_CBE 56.0842%-115 - C1 -1XEF 6.8 HLYBP_ECOLX
54 PsiBlast_CBE 55.8242%-113 - C1 -2FGJ 5.8 HLYBP_ECOLX
45 PsiBlast_CBE 55.5342%-117 - C1 -2FGK 7.2 HLYBP_ECOLX
33 PsiBlast_CBE 55.4944%-102 - C1 -3NHB 6.5
35 PsiBlast_CBE 55.4844% -97 - C1 -3NH9 6.2
56 PsiBlast_CBE 54.9842%-114 - C1 -1XEF 6.0
38 PsiBlast_CBE 54.8943%-112 - C1 -2PMK 6.8
34 PsiBlast_CBE 54.8944% -99 - C1 -3NHA 6.5
51 PsiBlast_CBE 54.7942%-120 - C1 -2FGJ 6.2
42 PsiBlast_CBE 54.5342%-119 - C1 -2FGK 6.5
40 PsiBlast_CBE 54.3943%-115 - C1 -2FF7 6.4
55 PsiBlast_CBE 54.3142%-114 - C1 -2FFA 6.4
44 PsiBlast_CBE 54.1942%-119 - C1 -2FGK 6.4 HLYBP_ECOLX
43 PsiBlast_CBE 53.9642%-116 - C1 -2FGK 6.0 HLYBP_ECOLX
52 PsiBlast_CBE 53.3242%-112 - C1 -2FGJ 7.0 HLYBP_ECOLX
39 PsiBlast_CBE 53.0643%-113 - C1 -3B5J 6.5
53 PsiBlast_CBE 53.0542%-113 - C1 -2FGJ 6.8 HLYBP_ECOLX
75 PsiBlast_CBE 49.3635%-107 - C1 -2IXF 6.3 TAP1_RAT
74 PsiBlast_CBE 48.7335%-107 - C1 -2IXF 6.6 TAP1_RAT
60 PsiBlast_CBE 47.9742%-110 - C1 -5DGX 4.0 ?
109 HHSearch 46.9339%-106 - C1 -1MV5 6.5 LMRA_LACLA
64 PsiBlast_CBE 45.1639%-102 - C1 -1MV5 6.5 LMRA_LACLA
81 PsiBlast_CBE 37.7331%-100 - C1 -3C41 5.3 ?