@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0655: (2016-03-17 )
MKPIFAVGDVHGEITLLDELLENWDKERERLLFVGDLIDRGENPAAVLRRVKALADQTGAIVLKGNHEQMLLDFLENPSGKMHYYLSQGGMETIQSLIADSLDKKMTPEGLAKRVKEEASELIDFIRKLPLYYEEGKYVFVHAGVDLTKKDWHDTEERDFFWIREPFLFGQNKTGKVFIFGHTPVQNLHIDESSGIWVSEDKTRLDIDGGAVFGGELHGVVVEEKVITKSFSVKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_A_4(1V73)
?
[Raw transfer]




120 Fugue 85.2231% -98 - C1 -1G5B - PP_LAMBD -
2 PsiBlast_PDB 81.4326% -86 - C3 -4J6O - ? -
102 HHSearch 79.0832% -78 - C1 -1G5B - PP_LAMBD -
100 HHSearch 74.1523%-105 - C1 -2QJC - ? -
121 Fugue 72.0125% -95 - C1 -2QJC - ? -
101 HHSearch 71.3527% -94 - C1 -2DFJ - APAH_SHIFL -
1 PsiBlast_PDB 70.0328% -74 - C1 -1G5B - PP_LAMBD -
103 HHSearch 69.4920% -92 * C1 *2Z72 - ? -
107 HHSearch 61.6121%-100 - C1 -3RQZ - ? -
105 HHSearch 59.7718% -74 - C1 -1FJM - PP1A_RABIT -
122 Fugue 58.0220% -76 - C1 -1V73 3.6 ?
3 PsiBlast_PDB 56.1428%-102 - C3 -2DFJ - APAH_SHIFL -
112 HHSearch 54.5720%-115 - C1 -1S3L - P936_METJA -
123 Fugue 54.4021% -73 - C1 -2DFJ - APAH_SHIFL -
109 HHSearch 54.0517% -85 - C1 -3QFM - ? -
104 HHSearch 54.0117% -74 - C1 -3H63 - PPP5_HUMAN -
108 HHSearch 53.7119% -58 - C1 -1AUI - PP2BA_HUMAN -
32 PsiBlast_CBE 51.9734%-104 - C3 -2NYM - PP2AA_HUMAN -
18 PsiBlast_PDB 51.9034%-102 - C3 -4I5N - PP2AA_HUMAN -
8 PsiBlast_PDB 51.6834%-112 - C3 -2QJC - ? -