@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0739: (2016-03-18 )
MFNLQKGFPENFKWGSSTNAQQFEGGYKEGGKGLSIADVRVIPDMPDESDFESFKTASDHYHHYKEDIAYYGEMGFQIYRFTMAWSRIFPNGDETEPNDAGVEFYSNMLAELEKYNIEPVVTLYAYDMPLQLLEKYNGWLDRAIIKDYLHYVETVVKLFKGRVKYWVPFNEQNFISIDSEYMSGYRAKNKAEVFQIQHHFNLCYAEATKLVHQIDPDAKVGGNIGNICPYPMTCKPEDVEASDKVAQQLGYAYGDIYFRGYYPKYFLKEYEGVDFEQIILDDDLTIIKSSEPDFMSLTYYMSSAIEAKGEEEVVVMNGIKAPNPYCETTEWGWTIDPYGFKHYLQEFYHRYQLPILILENGMGARDEKNTDDTIDDTYRIDYLASHIARMQEAVEEGCEIIGYLTWSATDLYSTREGFEKRYGFVYVDKDNSYKRLKKKSFYWYKKVIETNGNDLNY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BG6_A_3(4F66)
?
[Raw transfer]




BG6_B_7(4F66)
?
[Raw transfer]




GOL_A_3(4IPL)
?
[Raw transfer]




21 PsiBlast_CBE 93.2839% -73 - C1 -2XHY - BGLA_ECOLI -
94 HHSearch 93.1941% -69 - C1 -2XHY - BGLA_ECOLI -
3 PsiBlast_PDB 92.8939% -75 - C1 -4IPN - ? -
22 PsiBlast_CBE 92.6039% -73 - C1 -2XHY - BGLA_ECOLI -
8 PsiBlast_PDB 92.0738% -75 - C1 -3QOM - ? -
9 PsiBlast_PDB 91.7138% -75 - C1 -4GZE - ? -
2 PsiBlast_PDB 91.3639% -75 - C1 -4IPL 2.0 ?
1 PsiBlast_PDB 90.7639% -72 - C1 -2XHY - BGLA_ECOLI -
13 PsiBlast_PDB 89.9330% -75 - C1 -4HZ8 - ? -
14 PsiBlast_PDB 89.8930% -76 - C1 -3CMJ - ? -
23 PsiBlast_CBE 89.5439% -71 - C1 -2XHY - BGLA_ECOLI -
12 PsiBlast_PDB 89.0330% -78 - C1 -4HZ7 - ? -
24 PsiBlast_CBE 88.6239% -72 - C1 -4IPN - ? -
11 PsiBlast_PDB 88.5230% -75 - C1 -4HZ6 - ? -
5 PsiBlast_PDB 88.3338% -70 - C1 -4F79 - ? -
4 PsiBlast_PDB 87.7738% -70 - C1 -4F66 5.6 ?
25 PsiBlast_CBE 87.1638% -70 - C1 -4F66 5.4 ?
7 PsiBlast_PDB 87.1337% -70 - C1 -3PN8 - ? -
26 PsiBlast_CBE 87.1138% -72 - C1 -4GPN - ? -
6 PsiBlast_PDB 85.9938% -70 - C1 -4GPN - ? -