@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0799: (2016-03-18 )
MTAYPQFDVILKALNLSSVGVIITDPEQKDNPIIFVNTGFENITGYAKEEALGSNCHFLQGDDTDKEEVAKIRHAINEKSTANVLLKNYRKDGTSFMNELTIEPIYDDHEHLYFVGIQKDVTTEHDYQLELEKSLTEIEKLSTPIVPIKENICVLPLIGSLTHDRFQHMSEYVSEYMDHGKEDYLIMDLSGLAEFNEDAVMNLVKFHGFMKLTGVELIITGISPKFAMTLIRYEENLASLTTYSTIKEALQFY

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_2(2V1B)
?
[Raw transfer]




FMN_B_5(2PR5)
PHOT_BACSU
[Raw transfer]




FMN_A_4(2PR5)
PHOT_BACSU
[Raw transfer]




FMN_A_2(4EES)

[Raw transfer]




FMN_A_2(2V0W)
?
[Raw transfer]




FMN_D_4(4EET)

[Raw transfer]




FMN_A_4(2PR5)
PHOT_BACSU
[Raw transfer]




FMN_A_3(1N9L)
?
[Raw transfer]




FMN_B_4(4WF0)
?
[Raw transfer]




FMN_A_2(2V0U)
?
[Raw transfer]




FMN_A_3(4GCZ)
FIXL_BRADU
[Raw transfer]




FMN_A_3(1N9O)
?
[Raw transfer]




FMN_B_3(2PR6)
PHOT_BACSU
[Raw transfer]




FMN_B_2(1N9N)
?
[Raw transfer]




FMN_A_7(3UE6)
?
[Raw transfer]




FMN_A_2(2V0U)
?
[Raw transfer]




FMN_B_5(4HHD)

[Raw transfer]




FMN_A_3(2Z6D)
PHOT2_ARATH
[Raw transfer]




FMN_A_2(4EEU)

[Raw transfer]




FMN_A_2(4EER)

[Raw transfer]




FMN_A_4(2PR6)
PHOT_BACSU
[Raw transfer]




FMN_A_5(1JNU)
?
[Raw transfer]




FMN_E_12(3ULF)
?
[Raw transfer]




FMN_D_8(1JNU)
?
[Raw transfer]




FMN_B_3(4EET)
PHOT2_ARATH
[Raw transfer]




FMN_B_6(1JNU)
?
[Raw transfer]




FMN_A_3(2WKR)
RAC1_HUMAN
[Raw transfer]




FMN_A_7(3ULF)
?
[Raw transfer]




FMN_C_7(1JNU)
?
[Raw transfer]




FMN_A_7(3UE6)
?
[Raw transfer]




FMN_E_12(3UE6)
?
[Raw transfer]




FMN_C_10(3UE6)
?
[Raw transfer]




FMN_G_7(1G28)
?
[Raw transfer]




FMN_A_2(4EEP)

[Raw transfer]




FMN_A_3(3SW1)
?
[Raw transfer]




FMN_A_3(2Z6C)
PHOT1_ARATH
[Raw transfer]




FMN_B_4(2Z6C)

[Raw transfer]




FMN_A_3(2WKQ)
RAC1_HUMAN
[Raw transfer]




FMN_H_8(1G28)
?
[Raw transfer]




FMN_A_3(2WKP)
RAC1_HUMAN
[Raw transfer]




FMN_A_3(3T50)
LOVHK_BRUME
[Raw transfer]




RBF_A_2(4KUO)
?
[Raw transfer]




FMN_A_3(2Z6D)
PHOT2_ARATH
[Raw transfer]




FMN_B_8(3UE6)
?
[Raw transfer]




FMN_D_11(3UE6)
?
[Raw transfer]




FMN_A_3(3T50)
LOVHK_BRUME
[Raw transfer]




FMN_A_2(2V1A)
?
[Raw transfer]




FMN_E_5(1G28)
?
[Raw transfer]




FMN_F_6(1G28)
?
[Raw transfer]




FMN_A_3(4HHD)
PHOT1_ARATH
[Raw transfer]




FMN_C_10(3ULF)
?
[Raw transfer]




FMN_B_4(2Z6D)
PHOT2_ARATH
[Raw transfer]




FMN_B_8(3ULF)
?
[Raw transfer]




FMN_F_13(3UE6)
?
[Raw transfer]




FMN_F_13(3ULF)
?
[Raw transfer]




FMN_B_4(3T50)
LOVHK_BRUME
[Raw transfer]




FMN_E_5(1G28)
?
[Raw transfer]




FMN_D_11(3ULF)
?
[Raw transfer]




3 PsiBlast_PDB 83.4348% -66 - C2 -4GCZ 8.5 FIXL_BRADU (first)
24 PsiBlast_CBE 80.9940% -97 - C2 -3P7N - ? -
5 PsiBlast_PDB 79.8840% -84 - C2 -3P7N - ? -
22 PsiBlast_CBE 79.2252% -52 - C2 -2PR5 9.1 PHOT_BACSU
21 PsiBlast_CBE 78.8952% -56 - C2 -2PR6 6.3 PHOT_BACSU
1 PsiBlast_PDB 77.7652% -53 - C2 -2PR5 9.7 PHOT_BACSU
6 PsiBlast_PDB 76.4842% -87 - C2 -4KUO 8.5 ?
12 PsiBlast_PDB 76.0439% -72 - C2 -3UE6 7.2 ?
2 PsiBlast_PDB 75.3252% -56 - C2 -2PR6 6.7 PHOT_BACSU
98 HHSearch 75.1552% -55 - C2 -2PR5 9.7 PHOT_BACSU
23 PsiBlast_CBE 75.1542% -57 - C2 -3SW1 - ? -
96 HHSearch 74.6939% -69 - C2 -2Z6D 8.8 PHOT2_ARATH
32 PsiBlast_CBE 74.6339% -70 - C2 -3ULF 5.1 ?
27 PsiBlast_CBE 74.2239% -67 - C2 -3UE6 7.4 ?
28 PsiBlast_CBE 73.9439% -74 - C2 -3UE6 6.5 ?
4 PsiBlast_PDB 73.4042% -57 - C2 -3SW1 6.9 ?
11 PsiBlast_PDB 73.0146% -68 - C2 -2WKP 8.4 RAC1_HUMAN
8 PsiBlast_PDB 72.9947% -62 - C2 -1N9L 8.1 ?
31 PsiBlast_CBE 72.9839% -66 - C2 -3ULF 4.4 ?
13 PsiBlast_PDB 72.8939% -74 - C2 -3ULF 4.1 ?
7 PsiBlast_PDB 72.7945% -66 - C2 -2Z6D 8.9 PHOT2_ARATH
45 PsiBlast_CBE 72.4141% -73 - C2 -3T50 8.3 LOVHK_BRUME
99 HHSearch 72.3238% -66 - C2 -3T50 8.3 LOVHK_BRUME
104 HHSearch 71.8038% -55 - C2 -3UE6 7.2 ?
15 PsiBlast_PDB 71.7746% -60 - C2 -2V1B 6.3 ?
44 PsiBlast_CBE 71.7441% -78 - C2 -3T50 8.0 LOVHK_BRUME
16 PsiBlast_PDB 71.0446% -63 - C2 -2V0U 8.6 ?
14 PsiBlast_PDB 71.0246% -60 - C2 -2V1A 8.4 ?
43 PsiBlast_CBE 70.9245% -62 - C2 -2WKR 7.7 RAC1_HUMAN
95 HHSearch 70.8940% -52 - C2 -2V0U 8.6 ?
39 PsiBlast_CBE 70.7446% -71 - C2 -4EEP 8.6
9 PsiBlast_PDB 70.5047% -65 - C2 -1N9N 7.0 ?
17 PsiBlast_PDB 70.3946% -63 - C2 -2V0W 6.3 ?
18 PsiBlast_PDB 70.0748% -67 - C2 -4EES 9.2
37 PsiBlast_CBE 69.4344% -58 - C2 -2Z6C 8.6
47 PsiBlast_CBE 69.3945% -65 - C2 -4EER 8.8
26 PsiBlast_CBE 69.3839% -61 - C2 -3UE6 7.7 ?
10 PsiBlast_PDB 69.3747% -57 - C2 -1N9O 5.4 ?
40 PsiBlast_CBE 69.2845% -63 - C2 -2WKQ 8.5 RAC1_HUMAN
33 PsiBlast_CBE 68.6939% -68 - C2 -3ULF 3.2 ?
46 PsiBlast_CBE 68.3645% -71 - C2 -4EEU 8.9
36 PsiBlast_CBE 68.3548% -70 - C2 -4EET 9.0
29 PsiBlast_CBE 68.3539% -60 - C2 -3UE6 6.5 ?
25 PsiBlast_CBE 67.7845% -56 - C2 -2Z6D 8.2 PHOT2_ARATH
20 PsiBlast_PDB 67.7244% -60 - C2 -2Z6C 8.8 PHOT1_ARATH
35 PsiBlast_CBE 67.6939% -53 - C2 -3ULF 5.0 ?
19 PsiBlast_PDB 67.3648% -68 - C2 -4EET 9.1 PHOT2_ARATH
34 PsiBlast_CBE 67.1739% -69 - C2 -3ULF 3.4 ?
38 PsiBlast_CBE 67.0646% -63 - C2 -4WF0 8.0 ?
30 PsiBlast_CBE 65.9839% -52 - C2 -3UE6 7.7 ?
49 PsiBlast_CBE 65.5841% -60 - C2 -1JNU 5.7 ?
51 PsiBlast_CBE 65.2241% -59 - C2 -1JNU 5.8 ?
42 PsiBlast_CBE 64.8347% -56 - C2 -4HHD 7.7 PHOT1_ARATH
117 Fugue 64.8039% -55 * C2 *1G28 6.7 ?
50 PsiBlast_CBE 64.2041% -61 - C2 -1JNU 5.6 ?
41 PsiBlast_CBE 63.9747% -58 - C2 -4HHD 6.8
53 PsiBlast_CBE 63.8741% -63 - C2 -1G28 7.7 ?
48 PsiBlast_CBE 63.5841% -61 - C2 -1JNU 5.7 ?
54 PsiBlast_CBE 63.4841% -65 - C2 -1G28 7.5 ?
52 PsiBlast_CBE 62.8941% -64 - C2 -1G28 7.6 ?
55 PsiBlast_CBE 62.6841% -62 - C2 -1G28 7.7 ?