@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0816: (2016-03-18 )
MIKLCTISDSQALLEVSYKTFDETFRAQNKPENMDAYLKTNFTAKKLSDELKNPHSYFYFVFHQEAIAGYLKLNIGDAQTEEIAGNTIEIERIYVLKSFQKKGLGKELFNQAIEIAKEVDAKKIWLGVWEKNKNAIQFYAKLGFIKNGQHDFFMGDDCQTDIIMIKDL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_A_4(1TIQ)
PAIA_BACSU
[Raw transfer]




COA_A_5(1TIQ)
PAIA_BACSU
[Raw transfer]




COA_A_5(1TIQ)
PAIA_BACSU
[Raw transfer]




63 HHSearch 96.6154%-114 * C2 *1TIQ 3.3 PAIA_BACSU
1 PsiBlast_PDB 95.7553%-110 - C2 -1TIQ 10.5 PAIA_BACSU
2 PsiBlast_PDB 80.4239%-108 * C1 *4E2A - ? -
4 PsiBlast_PDB 72.9924% -85 - C2 -1WK4 - ? -
69 HHSearch 72.1616%-116 - C2 -1GHE - TTR_PSEAJ -
5 PsiBlast_PDB 72.0524% -86 - C2 -2CY2 - ? -
6 PsiBlast_PDB 69.1324%-123 - C1 -3FIX - PAIA_THEAC -
7 PsiBlast_PDB 68.5624%-126 - C1 -3NE7 - PAIA_THEAC -
9 PsiBlast_PDB 68.5424%-126 - C1 -3F0A - PAIA_THEAC -
8 PsiBlast_PDB 67.8124%-134 - C1 -3K9U - PAIA_THEAC -
66 HHSearch 66.8221% -86 - C2 -2CY2 - ? -
64 HHSearch 66.6719%-112 - C2 -2DXQ - ? -
83 HHSearch 66.4122%-112 - C2 -2I79 - ? -
86 Fugue 65.7619%-101 - C2 -1P0H - MSHD_MYCTU -
84 Fugue 64.9420% -72 - C2 -2CY2 - ? -
71 HHSearch 63.9421%-104 - C2 -1Z4E - ? -
80 HHSearch 63.0019%-117 - C2 -2AE6 - ? -
87 Fugue 62.5016%-111 - C2 -2FIA - ? -
65 HHSearch 62.1620%-109 - C2 -3FNC - ? -
68 HHSearch 61.8920% -92 - C2 -1U6M - ? -