@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0823: (2016-03-18 )
LNLKDTVKLANGVEMPRLGFGVWKVQDGDEAVNSVKWAIEAGYISIDTAAAYKNEEGVGQAIKESGIKREDLFVTTKLWNAEQGYESTLAAFDESLRKLELDYVDLYLIHWPVKGKFKDTWRAFEKLYKDKRVRAIGVCNFHEHHLKELMEDAEIAPMVNQIELHPQLTQEPLRKFCAENNIVVEAWSPLGNGKLLSNPEIKAIADAHGKSVAQVILRWDLQIGVVTIPKSVHQERIIQNADIFDFELTEEEVAKISGLNKDERTGPDPDNFNF

Atome Classification :

(97 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_B_6(3WBW)
?
[Raw transfer]




NDP_B_4(3D3F)
GR_BACSU
[Raw transfer]




NAP_A_5(3FX4)
AK1A1_PIG
[Raw transfer]




NDP_A_3(3D3F)
GR_BACSU
[Raw transfer]




NDP_A_4(3WBW)
?
[Raw transfer]




NDP_A_2(1US0)
ALDR_HUMAN
[Raw transfer]




NAP_X_2(1ZUA)
AK1BA_HUMAN
[Raw transfer]




NAP_A_3(4GIE)
PGFS_TRYCC
[Raw transfer]




NAP_A_6(3CV7)
AK1A1_PIG
[Raw transfer]




NAP_B_5(3UZW)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(4GAB)
AK1BA_HUMAN
[Raw transfer]




NAP_B_4(1VP5)
?
[Raw transfer]




NAD_C_3(1M9H)
DKGA_CORSC
[Raw transfer]




NDP_A_4(3WBW)
?
[Raw transfer]




NDP_B_4(4G5D)
PGFS_LEIMA
[Raw transfer]




NAP_A_2(4GA8)
AK1BA_HUMAN
[Raw transfer]




NAP_A_3(3H4G)
AK1A1_PIG
[Raw transfer]




NDP_A_3(4G5D)
PGFS_LEIMA
[Raw transfer]




NDP_A_2(2BGS)
ALDR_HORVU
[Raw transfer]




NAP_A_3(3UZX)
AK1D1_HUMAN
[Raw transfer]




NAP_C_3(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_B_6(3UZZ)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(3UZY)
AK1D1_HUMAN
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NAP_A_3(1VP5)
?
[Raw transfer]




NAP_B_6(3UZX)
AK1D1_HUMAN
[Raw transfer]




NAP_C_3(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_D_4(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_B_6(3UZY)
AK1D1_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_A_2(4GQG)
AK1BA_HUMAN
[Raw transfer]




NAP_A_3(4GQ0)
AK1BA_HUMAN
[Raw transfer]




NAP_D_4(1VBJ)
PGFS_TRYBB
[Raw transfer]




NAP_A_2(3GUG)
AK1C1_HUMAN
[Raw transfer]




NAP_A_2(3H7U)
AKRC9_ARATH
[Raw transfer]




NAP_B_2(1A80)
DKGA_CORSC
[Raw transfer]




NAP_A_3(4L1X)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JQ4)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JQ1)
AK1C2_HUMAN
[Raw transfer]




NDP_A_7(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NAP_B_6(4L1X)
AK1C2_HUMAN
[Raw transfer]




NAP_A_3(3C3U)
AK1C1_HUMAN
[Raw transfer]




NAP_A_4(4JQA)
AK1C2_HUMAN
[Raw transfer]




NAP_A_3(4L1W)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JQA)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JQ3)
AK1C2_HUMAN
[Raw transfer]




NAP_C_3(1IHI)
AK1C2_HUMAN
[Raw transfer]




NAP_B_6(4L1W)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JQ3)
AK1C2_HUMAN
[Raw transfer]




NAP_A_3(3UZZ)
AK1D1_HUMAN
[Raw transfer]




NAP_A_8(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(1MRQ)
AK1C1_HUMAN
[Raw transfer]




NAP_B_2(1HQT)
AK1A1_PIG
[Raw transfer]




NAP_B_9(4JTR)
AK1C2_HUMAN
[Raw transfer]




NAP_A_6(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JTQ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_5(1J96)
AK1C2_HUMAN
[Raw transfer]




NAP_B_10(4JQ4)
AK1C2_HUMAN
[Raw transfer]




NAP_B_7(1J96)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JQ2)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JQ1)
AK1C2_HUMAN
[Raw transfer]




NAP_A_4(4JTR)
AK1C2_HUMAN
[Raw transfer]




NAP_B_8(4JTQ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_2(3NTY)
AK1C1_HUMAN
[Raw transfer]




NAP_B_8(4JQ2)
AK1C2_HUMAN
[Raw transfer]




NAP_X_2(4JII)
AK1BA_HUMAN
[Raw transfer]




NAP_A_3(4JIH)
AK1BA_HUMAN
[Raw transfer]




NAP_B_9(1XJB)
AK1C2_HUMAN
[Raw transfer]




NAP_B_7(2IPJ)
AK1C2_HUMAN
[Raw transfer]




NAP_A_3(4I5X)
AK1BA_HUMAN
[Raw transfer]




NDP_B_8(2HDJ)
AK1C2_HUMAN
[Raw transfer]




NDP_B_4(3WBY)
?
[Raw transfer]




NA7_B_4(2WZM)
Y2407_MYCS2
[Raw transfer]




NDP_A_3(3WBY)
?
[Raw transfer]




NA7_A_3(2WZM)
Y2407_MYCS2
[Raw transfer]




NA7_A_3(2WZM)
Y2407_MYCS2
[Raw transfer]




GLU_A_3(4FZI)
PGFS_TRYCC
[Raw transfer]




GOL_H_8(1MZR)
DKGA_ECOLI
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




EDO_B_20(4F40)
PGFS_LEIMA
[Raw transfer]




CIT_E_5(1VBJ)
PGFS_TRYBB
[Raw transfer]




GOL_C_10(3O0K)
?
[Raw transfer]




GOL_I_9(1MZR)
DKGA_ECOLI
[Raw transfer]




CIT_F_6(1VBJ)
PGFS_TRYBB
[Raw transfer]




GLU_B_4(4FZI)
PGFS_TRYCC
[Raw transfer]




GOL_I_9(1MZR)
DKGA_ECOLI
[Raw transfer]




GOL_C_10(3O0K)
?
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




GOL_D_12(3O0K)
?
[Raw transfer]




C2U_A_7(3CV7)
AK1A1_PIG
[Raw transfer]




EDO_A_12(4F40)
PGFS_LEIMA
[Raw transfer]




FX4_A_6(3FX4)
AK1A1_PIG
[Raw transfer]




EPR_A_2(4JIH)
AK1BA_HUMAN
[Raw transfer]




FLC_A_4(4GAC)
AK1A1_MOUSE
[Raw transfer]




FLC_B_6(4GAC)
AK1A1_MOUSE
[Raw transfer]




2 PsiBlast_PDB 95.6667% -85 - C5 -3D3F 9.9 GR_BACSU
1 PsiBlast_PDB 95.3567% -89 - C5 -3F7J - GR_BACSU -
21 PsiBlast_CBE 95.1467% -88 - C5 -3F7J - GR_BACSU -
104 HHSearch 94.6467% -89 - C5 -3F7J - GR_BACSU -
8 PsiBlast_PDB 94.6058% -93 - C5 -3B3D - YTBE_BACSU -
27 PsiBlast_CBE 94.5558% -92 - C5 -3B3D - YTBE_BACSU -
28 PsiBlast_CBE 93.7158% -93 - C5 -3B3D - YTBE_BACSU -
22 PsiBlast_CBE 93.3967% -91 - C5 -3D3F 10.2 GR_BACSU
3 PsiBlast_PDB 92.7160% -92 - C5 -1VBJ 10.9 PGFS_TRYBB
102 HHSearch 92.3761% -91 - C5 -1VBJ 12.0 PGFS_TRYBB
103 HHSearch 92.3159% -88 - C5 -3B3D - YTBE_BACSU -
7 PsiBlast_PDB 91.2858% -91 - C5 -4GIE 12.9 PGFS_TRYCC
23 PsiBlast_CBE 91.0960% -88 - C5 -1VBJ 8.6 PGFS_TRYBB
6 PsiBlast_PDB 90.4958% -88 - C5 -4FZI 2.9 PGFS_TRYCC
25 PsiBlast_CBE 90.2959% -92 - C5 -4F40 2.9 PGFS_LEIMA
4 PsiBlast_PDB 90.1559% -89 - C5 -4F40 2.5 PGFS_LEIMA
26 PsiBlast_CBE 90.0658% -93 - C5 -4FZI 2.8 PGFS_TRYCC
35 PsiBlast_CBE 89.6350% -97 - C5 -4Q3M - ? -
5 PsiBlast_PDB 89.5259% -87 - C5 -4G5D 12.8 PGFS_LEIMA
24 PsiBlast_CBE 89.3559% -85 - C5 -4G5D 12.9 PGFS_LEIMA
110 HHSearch 87.5646% -83 - C5 -1MZR 1.9 DKGA_ECOLI
13 PsiBlast_PDB 87.0945% -89 - C5 -1MZR 2.3 DKGA_ECOLI
31 PsiBlast_CBE 86.1655%-100 - C5 -3O0K 2.0 ?
9 PsiBlast_PDB 85.8155% -96 - C5 -3O0K 2.7 ?
29 PsiBlast_CBE 85.7055% -93 - C5 -3O0K 2.4 ?
106 HHSearch 85.4255% -92 - C5 -3O0K 2.7 ?
30 PsiBlast_CBE 85.2555% -98 - C5 -3O0K 2.9 ?
41 PsiBlast_CBE 84.9250% -97 - C5 -1VP5 11.8 ?
16 PsiBlast_PDB 84.6450% -98 - C5 -1VP5 11.9 ?
108 HHSearch 84.1350% -85 - C5 -1VP5 12.0 ?
101 HHSearch 83.6949% -84 - C5 -2WZM 8.2 Y2407_MYCS2
40 PsiBlast_CBE 83.4644% -91 - C5 -3WBW 11.2 ?
11 PsiBlast_PDB 82.8748% -87 - C5 -2WZM 8.4 Y2407_MYCS2
37 PsiBlast_CBE 82.8148% -90 - C5 -2WZM 8.4 Y2407_MYCS2
14 PsiBlast_PDB 82.7044% -90 - C5 -3WBW 11.3 ?
44 PsiBlast_CBE 82.4636% -95 - C5 -4GAC 3.6 AK1A1_MOUSE
42 PsiBlast_CBE 82.0844% -87 - C5 -3WBY 5.7 ?
46 PsiBlast_CBE 81.9244% -87 - C5 -1M9H 9.0 DKGA_CORSC
117 HHSearch 81.1939% -80 - C5 -3H7U 10.0 AKRC9_ARATH
43 PsiBlast_CBE 81.1744% -86 - C5 -1A80 10.6 DKGA_CORSC
17 PsiBlast_PDB 81.0144% -87 - C5 -3WBY 4.9 ?
61 PsiBlast_CBE 80.5737% -91 - C5 -3H7U 10.0 AKRC9_ARATH
45 PsiBlast_CBE 80.5736% -91 - C5 -4GAC 2.4 AK1A1_MOUSE
56 PsiBlast_CBE 80.4236% -88 - C5 -3FX4 10.0 AK1A1_PIG
51 PsiBlast_CBE 80.4238% -94 - C5 -4JII 12.8 AK1BA_HUMAN
64 PsiBlast_CBE 79.8338% -95 - C5 -4JTQ 12.7 AK1C2_HUMAN
49 PsiBlast_CBE 79.7738% -92 - C5 -1ZUA 10.6 AK1BA_HUMAN
48 PsiBlast_CBE 79.7738% -93 - C5 -4GA8 13.2 AK1BA_HUMAN
112 HHSearch 79.7644% -86 - C5 -3WBW 11.2 ?
75 PsiBlast_CBE 79.6938% -93 - C5 -4JQ1 12.5 AK1C2_HUMAN
82 PsiBlast_CBE 79.6638% -90 - C5 -2HDJ 11.5 AK1C2_HUMAN
50 PsiBlast_CBE 79.6638% -93 - C5 -4JIH 12.6 AK1BA_HUMAN
47 PsiBlast_CBE 79.6638% -92 - C5 -4GAB 13.1 AK1BA_HUMAN
63 PsiBlast_CBE 79.6238% -92 - C5 -4JTR 13.0 AK1C2_HUMAN
81 PsiBlast_CBE 79.5838% -89 - C5 -1XJB 12.2 AK1C2_HUMAN
60 PsiBlast_CBE 79.5036% -83 - C5 -1HQT 7.7 AK1A1_PIG
76 PsiBlast_CBE 79.4438% -90 - C5 -1J96 12.9 AK1C2_HUMAN
65 PsiBlast_CBE 79.4338% -92 - C5 -4JTQ 12.8 AK1C2_HUMAN
66 PsiBlast_CBE 79.3838% -91 - C5 -4JQA 12.0 AK1C2_HUMAN
71 PsiBlast_CBE 79.3338% -89 - C5 -4JQ3 10.4 AK1C2_HUMAN
69 PsiBlast_CBE 79.1838% -93 - C5 -4JQ4 13.0 AK1C2_HUMAN
67 PsiBlast_CBE 79.1338% -92 - C5 -4JQA 12.7 AK1C2_HUMAN
79 PsiBlast_CBE 79.0538% -93 - C5 -4L1W 12.5 AK1C2_HUMAN
78 PsiBlast_CBE 79.0538% -91 - C5 -4L1W 12.1 AK1C2_HUMAN
57 PsiBlast_CBE 79.0536% -87 - C5 -3CV7 9.0 AK1A1_PIG
73 PsiBlast_CBE 79.0038% -91 - C5 -4JQ2 12.8 AK1C2_HUMAN
80 PsiBlast_CBE 78.9938% -90 - C5 -1XJB 12.3 AK1C2_HUMAN
62 PsiBlast_CBE 78.9238% -92 - C5 -4JTR 12.5 AK1C2_HUMAN
77 PsiBlast_CBE 78.8738% -91 - C5 -1J96 12.5 AK1C2_HUMAN
70 PsiBlast_CBE 78.8138% -90 - C5 -4JQ3 11.4 AK1C2_HUMAN
54 PsiBlast_CBE 78.7838% -93 - C5 -4I5X 12.4 AK1BA_HUMAN
55 PsiBlast_CBE 78.7636% -86 - C5 -3H4G 10.2 AK1A1_PIG
72 PsiBlast_CBE 78.7438% -92 - C5 -4JQ2 11.9 AK1C2_HUMAN
53 PsiBlast_CBE 78.6538% -95 - C5 -4GQ0 13.1 AK1BA_HUMAN (first)
83 PsiBlast_CBE 78.5538% -88 - C5 -2HDJ 12.2 AK1C2_HUMAN
88 PsiBlast_CBE 78.5238% -88 - C5 -2IPJ 11.8 AK1C2_HUMAN
86 PsiBlast_CBE 78.4638% -91 - C5 -4L1X 4.9 AK1C2_HUMAN
52 PsiBlast_CBE 78.4038% -92 - C5 -4GQG 12.8 AK1BA_HUMAN
92 PsiBlast_CBE 78.2437% -89 - C5 -3C3U 11.4 AK1C1_HUMAN
85 PsiBlast_CBE 78.0638% -86 - C5 -1IHI 12.1 AK1C2_HUMAN
74 PsiBlast_CBE 77.9238% -91 - C5 -4JQ1 12.8 AK1C2_HUMAN
89 PsiBlast_CBE 77.8938% -89 - C5 -2IPJ 12.1 AK1C2_HUMAN
87 PsiBlast_CBE 77.8538% -90 - C5 -4L1X 5.5 AK1C2_HUMAN
116 HHSearch 77.7543% -80 - C5 -1US0 13.1 ALDR_HUMAN
90 PsiBlast_CBE 77.7537% -95 - C5 -3GUG 11.9 AK1C1_HUMAN
84 PsiBlast_CBE 77.7038% -86 - C5 -1IHI 11.9 AK1C2_HUMAN
91 PsiBlast_CBE 77.6137% -87 - C5 -3NTY 12.3 AK1C1_HUMAN
68 PsiBlast_CBE 77.2838% -91 - C5 -4JQ4 12.6 AK1C2_HUMAN
96 PsiBlast_CBE 77.2236% -91 - C5 -3UZY 9.7 AK1D1_HUMAN
98 PsiBlast_CBE 77.1136% -91 - C5 -3UZX 9.8 AK1D1_HUMAN
94 PsiBlast_CBE 76.8536% -90 - C5 -3UZZ 9.7 AK1D1_HUMAN
93 PsiBlast_CBE 76.5637% -90 - C5 -1MRQ 12.8 AK1C1_HUMAN
100 PsiBlast_CBE 76.4836% -92 - C5 -3UZW 9.8 AK1D1_HUMAN
97 PsiBlast_CBE 75.9536% -92 - C5 -3UZY 9.6 AK1D1_HUMAN
99 PsiBlast_CBE 75.8036% -91 - C5 -3UZX 9.5 AK1D1_HUMAN
95 PsiBlast_CBE 75.3336% -90 - C5 -3UZZ 10.2 AK1D1_HUMAN
121 HHSearch 74.8637% -72 - C5 -2BGS 10.4 ALDR_HORVU