@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0877: (2016-03-19 )
MKLIINENEQLVAETVSRRIIELVKEKPASLICIAGGDTPLLTIEALIKANQAGEVDFSNTQFVGLDEWVGLGRETKGSCIQTLYDAFFDRLKNVSSEQICFFDGKATSLTDECARVDKFIDDRGGMDFILLGIGLNGHIGFNEPFVPVDVNCHVVELDDVTKRVMSKYFDTDLPLTHGISLGMQQILAAKEIFLVATGEKKIDIVKQVVEKEPTVAIPATLVKDSNTMLVVDKIAASGVEA

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

F6R_A_3(2BKX)
NAGB_BACSU
[Raw transfer]




F6R_A_3(2BKX)
NAGB_BACSU
[Raw transfer]




F6R_B_4(2BKX)
NAGB_BACSU
[Raw transfer]




GLP_B_4(2RI1)
NAGB_STRMU
[Raw transfer]




GLP_A_3(2RI1)
NAGB_STRMU
[Raw transfer]




PGA_A_3(2BKV)
NAGB_BACSU
[Raw transfer]




PGA_B_4(2BKV)
NAGB_BACSU
[Raw transfer]




38 HHSearch 93.8032%-125 - C3 -2BKX 3.8 NAGB_BACSU
2 PsiBlast_PDB 93.5532%-117 - C3 -2BKX 3.8 NAGB_BACSU
22 PsiBlast_CBE 92.9932%-118 - C3 -2BKV 2.7 NAGB_BACSU
1 PsiBlast_PDB 92.2332%-116 - C3 -2BKV 2.6 NAGB_BACSU
21 PsiBlast_CBE 92.1732%-117 - C3 -2BKX 3.8 NAGB_BACSU
39 HHSearch 89.1423%-125 - C3 -3HN6 - NAGB_BORBU -
29 Fugue 88.6126%-123 - C3 -1NE7 - GNPI1_HUMAN -
40 HHSearch 88.3326%-121 * C3 *1NE7 - GNPI1_HUMAN -
44 HHSearch 87.8230%-130 - C3 -2RI0 - NAGB_STRMU -
28 Fugue 87.3124%-124 - C3 -1DEA - NAGB_ECOLI -
37 HHSearch 86.6124%-124 - C3 -1FS5 - NAGB_ECOLI -
10 PsiBlast_PDB 84.0627%-128 - C3 -1FS6 - NAGB_ECOLI -
12 PsiBlast_PDB 83.8727%-125 - C3 -2WU1 - NAGB_ECOLI -
6 PsiBlast_PDB 83.6027%-123 - C3 -1CD5 - NAGB_ECOLI -
11 PsiBlast_PDB 83.5127%-126 - C3 -1FSF - NAGB_ECOLI -
9 PsiBlast_PDB 83.4227%-125 - C3 -1FS5 - NAGB_ECOLI -
8 PsiBlast_PDB 83.4227%-124 - C3 -1FRZ - NAGB_ECOLI -
7 PsiBlast_PDB 83.4027%-124 - C3 -1FQO - NAGB_ECOLI -
5 PsiBlast_PDB 82.8427%-123 - C3 -1HOT - NAGB_ECOLI -
23 PsiBlast_CBE 82.3932%-125 - C3 -2RI0 - NAGB_STRMU -
15 PsiBlast_PDB 81.2532%-127 - C3 -2RI1 3.4 NAGB_STRMU
24 PsiBlast_CBE 80.2532%-122 - C3 -2RI1 3.3 NAGB_STRMU