@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0970: (2016-03-20 )
MNLSLEGKTYVVMGVANKRSIAWAIARSLNEAGAKLVFTYADDRAKKSITELVPSLSEVNQNPLILACDVTSEEAITETFETIKDKAGKLSGLAHCIAFANKDFLTGDYLEVDRKSFLQAHEISAYSFTAVARALKHLEMLTEDASLLTLTYLGGERVVENYNIMGVAKASLDASVRYLAMDLGAIGVRVNAISAGPIRTVSARGVSGFSDSISLVEERAPLKRATQAEEVGDTAYYLFSNLSRGVTGEVIHVDSGYHIIGF

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_C_12(4CV0)
?
[Raw transfer]




NAP_G_9(3GR6)
FABI_STAAR
[Raw transfer]




NAP_B_6(4NZ9)
?
[Raw transfer]




NDP_D_15(4CV0)
?
[Raw transfer]




NAD_D_7(3OIF)
FABI_BACSU
[Raw transfer]




NAP_A_4(4NZ9)
?
[Raw transfer]




NAP_A_5(3GR6)
FABI_STAAR
[Raw transfer]




NAP_A_6(4ALL)
?
[Raw transfer]




NAP_B_7(4ALL)
?
[Raw transfer]




NAP_D_7(3GR6)
FABI_STAAR
[Raw transfer]




NAD_A_5(2QIO)
?
[Raw transfer]




NDP_C_12(3OJF)
FABI_BACCR
[Raw transfer]




NAD_A_2(3OIG)
FABI_BACSU
[Raw transfer]




NDP_B_10(3OJF)
FABI_BACCR
[Raw transfer]




NAD_D_11(2QIO)
?
[Raw transfer]




NAD_C_9(2QIO)
?
[Raw transfer]




NDP_A_5(4CV0)
?
[Raw transfer]




NDP_B_8(4CV0)
?
[Raw transfer]




NAD_A_5(3OIF)
FABI_BACSU
[Raw transfer]




NDP_A_6(3OJF)
FABI_BACCR
[Raw transfer]




NDP_D_8(3OJF)
FABI_BACCR
[Raw transfer]




NAP_C_9(4ALL)
?
[Raw transfer]




NAP_D_12(4ALL)
?
[Raw transfer]




NAP_J_11(3GR6)
FABI_STAAR
[Raw transfer]




NAD_B_7(2QIO)
?
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




IMJ_B_9(3OJF)
FABI_BACCR
[Raw transfer]




IMJ_C_11(3OJF)
FABI_BACCR
[Raw transfer]




1JT_B_5(4NZ9)
?
[Raw transfer]




1JT_A_3(4NZ9)
?
[Raw transfer]




1 PsiBlast_PDB 98.5863%-118 - C3 -2QIO 10.8 ?
21 PsiBlast_CBE 98.2063%-119 - C3 -2QIO 10.9 ?
22 PsiBlast_CBE 98.1563%-120 - C3 -2QIO 10.6 ?
24 PsiBlast_CBE 98.1362%-120 - C3 -3OJF 11.3 FABI_BACCR
23 PsiBlast_CBE 97.6663%-119 - C3 -2QIO 10.8 ?
25 PsiBlast_CBE 97.2562%-120 - C3 -3OJF 10.6 FABI_BACCR
3 PsiBlast_PDB 97.1862%-122 - C3 -3OJF 10.7 FABI_BACCR
26 PsiBlast_CBE 96.9262%-119 - C3 -3OJF 11.1 FABI_BACCR
5 PsiBlast_PDB 96.8561%-115 - C3 -3OIG 11.4 FABI_BACSU
4 PsiBlast_PDB 96.3761%-114 - C3 -3OIF 10.3 FABI_BACSU
27 PsiBlast_CBE 95.6861%-112 - C3 -3OIF 10.4 FABI_BACSU
101 PsiBlast_CBE 92.6853%-114 - C3 -4BNN - ? -
80 PsiBlast_CBE 92.5753%-114 - C3 -4CV1 - ? -
64 PsiBlast_CBE 92.5653%-112 - C3 -4D42 - ? -
72 PsiBlast_CBE 92.5353%-113 - C3 -4D41 - ? -
40 PsiBlast_CBE 92.5153%-112 - C3 -4D45 - ? -
19 PsiBlast_PDB 92.4653%-112 - C3 -4BNI - ? -
13 PsiBlast_PDB 92.3853%-114 - C3 -4ALK - ? -
66 PsiBlast_CBE 92.3653%-113 - C3 -4D42 - ? -
63 PsiBlast_CBE 92.2553%-113 - C3 -4D42 - ? -
10 PsiBlast_PDB 91.9653%-113 - C3 -4NZ9 11.5 ?
86 PsiBlast_CBE 91.6553%-115 - C3 -4CV0 11.1 ?
30 PsiBlast_CBE 91.6353%-114 - C3 -4ALL 10.1 ?
29 PsiBlast_CBE 91.5853%-114 - C3 -4ALL 10.4 ?
85 PsiBlast_CBE 91.5753%-114 - C3 -4CV0 10.0 ?
28 PsiBlast_CBE 91.4953%-113 - C3 -4ALL 9.9 ?
9 PsiBlast_PDB 91.4553%-107 - C3 -3GR6 10.6 FABI_STAAR
33 PsiBlast_CBE 91.2253%-108 - C3 -3GR6 10.6 FABI_STAAR
31 PsiBlast_CBE 91.0853%-112 - C3 -3GR6 8.5 FABI_STAAR
6 PsiBlast_PDB 91.0453%-112 - C3 -4ALL 9.6 ?
83 PsiBlast_CBE 91.0053%-112 - C3 -4CV0 10.5 ?
34 PsiBlast_CBE 90.8753%-109 - C3 -4NZ9 11.8 ?
84 PsiBlast_CBE 90.7353%-110 - C3 -4CV0 11.2 ?
32 PsiBlast_CBE 90.6953%-109 - C3 -3GR6 9.7 FABI_STAAR
105 Fugue 79.8346%-124 - C3 -1DFI 5.6 FABI_ECOLI