@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0974: (2016-03-20 )
MTTSIIERIDAWAEKTPDFPCYEYAGTRLSYKELKRQSDAFGSFLLKNLITDKEKPIIVYGHMSPLMLVAFLGSIKSGRAYVPVDVSMPVERIEQIKKAADPSMFICTEELPNNLTITGCPVLTQDQLMDALEKHFGEVPDKEACVNNDDNYYIIYTSGSTGNPKGVQISQNNLVSFSNWILQDFSLSQGLRFLNQAPFSFDLSVMDLYPSLLSGGTLVPLDKTITANMKDLYREIPAQNLDVWVSTPSFADLCLLDENFNQENNPRLTRFLFCGEVLAKKTASELLDRFPDAVIYNTYGPTEATVAVTQVKVTREIIDAYPSLPLGVIKPDMRLHIVDQETGEVLPEGEKGEIVLIGASVSKGYLNEPEKTDQVFFDYKGYQAYRTGDSGIIKDGYLFFQGRLDFQIKLHGYRIELEDIENNLKKVSYIQNCAIIPKMKDEKVDMLVAQVIPTTHDFEKEYQLSAAIKKELKEFMPAYMIPRKWIYKTDFPLTMNGKIDRKSLNSEVNK

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(3FCE)
DLTA_BACCR
[Raw transfer]




ATP_A_3(3FCC)
DLTA_BACCR
[Raw transfer]




AMP_A_3(3DHV)
DLTA_BACCR
[Raw transfer]




GAP_A_2(4OXI)
?
[Raw transfer]




AMP_A_2(3E7X)
DLTA_BACSU
[Raw transfer]




ANP_A_3(4D4I)
?
[Raw transfer]




ANP_A_2(4D4G)
?
[Raw transfer]




AMP_A_2(3VNS)
?
[Raw transfer]




AMP_A_3(3E7W)
DLTA_BACSU
[Raw transfer]




AMP_A_3(3E7W)
DLTA_BACSU
[Raw transfer]




ATP_A_2(3VNQ)
?
[Raw transfer]




1 PsiBlast_PDB 97.3950%-109 - C3 -3FCC 6.4 DLTA_BACCR
2 PsiBlast_PDB 97.0150%-108 - C3 -3FCE 7.0 DLTA_BACCR
6 PsiBlast_PDB 96.1250%-100 - C3 -3E7X 6.8 DLTA_BACSU
3 PsiBlast_PDB 96.0650%-105 - C3 -3DHV 4.8 DLTA_BACCR
5 PsiBlast_PDB 95.1750%-101 - C3 -3E7W 6.0 DLTA_BACSU
22 PsiBlast_CBE 94.9945%-100 - C3 -3LGX - DLTA_STRP1 -
28 HHSearch 94.9550%-100 - C3 -3E7W 6.0 DLTA_BACSU
4 PsiBlast_PDB 93.6550%-112 - C3 -4PZP - DLTA_BACCR -
21 PsiBlast_CBE 93.3245%-101 - C3 -3LGX - DLTA_STRP1 -
8 PsiBlast_PDB 92.4945% -97 - C3 -3LGX - DLTA_STRP1 -
23 PsiBlast_CBE 92.1345% -97 - C3 -3LGX - DLTA_STRP1 -
7 PsiBlast_PDB 91.9345% -98 - C3 -3L8C - DLTA_STRP6 -
14 PsiBlast_PDB 75.2828% -86 - C3 -4D57 - ? -
12 PsiBlast_PDB 75.2528% -87 - C3 -4D4I 5.9 ?
13 PsiBlast_PDB 74.9428% -86 - C3 -4D56 - ? -
10 PsiBlast_PDB 73.4828% -87 - C3 -4D4G 6.6 ?
19 PsiBlast_PDB 71.6526% -88 - C3 -4DG8 - ? -
9 PsiBlast_PDB 71.0529% -84 - C3 -2VSQ - -
49 Fugue 70.2325% -86 - C3 -1AMU - GRSA_ANEMI -
20 PsiBlast_PDB 70.1626% -87 - C3 -4DG9 - ? -
17 PsiBlast_PDB 68.0230% -74 - C3 -3VNQ 7.3 ?
18 PsiBlast_PDB 67.8530% -73 - C3 -3VNS 5.3 ?