@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1039: (2016-03-21 )
MLRLQFHKKLPFHDLNIDYTFEKPVTAMMGASGSGKSTLFQCVSGLKSIDGGIIEFDGTPWDDSNISLHLPVTERKVGYLFQNLALFPNMNVYENIAFGLKVKKKKKKEQAEIQQQVRKMSDYLQISHLLYSSVQKLSGGEKQRVAMARAMITEPKLLLLDEPFNGLDEETRLICMKLVGQMAKDFHIPVIFVTHYASEAEMMTEEILVMREGRLEKRKS

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_C_9(1MV5)
LMRA_LACLA
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_7(1MV5)
LMRA_LACLA
[Raw transfer]




ACP_A_4(4AYT)
ABCBA_HUMAN
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ADP_B_8(1MV5)
LMRA_LACLA
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ACP_A_4(4AYX)
ABCBA_HUMAN
[Raw transfer]




ADP_D_10(1MV5)

[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ANP_A_2(4AYW)
ABCBA_HUMAN
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




GOL_A_5(4P33)
LPTB_ECOLI
[Raw transfer]




GOL_B_11(4P33)
LPTB_ECOLI
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




120 HHSearch 89.8640%-108 - C1 -2IT1 - ? -
123 HHSearch 86.8734%-114 - C1 -3RLF - MALK_ECOLI -
23 PsiBlast_CBE 85.6636%-123 - C1 -2ONK - WTPC_ARCFU -
24 PsiBlast_CBE 84.8636%-122 - C1 -2ONK - WTPC_ARCFU -
12 PsiBlast_PDB 84.8336%-115 - C1 -3PUY - MALK_ECOLI -
17 PsiBlast_PDB 84.8136%-121 - C1 -3PUX - MALK_ECOLI -
121 HHSearch 84.6936%-109 - C1 -1V43 - ? -
28 PsiBlast_CBE 84.6136%-118 - C1 -3PUZ - MALK_ECOLI -
122 HHSearch 84.4736%-100 - C1 -3FVQ - FBPC_NEIG1 -
2 PsiBlast_PDB 84.4536%-119 - C1 -2ONK - WTPC_ARCFU -
15 PsiBlast_PDB 84.3736%-117 - C1 -3PUV - MALK_ECOLI -
16 PsiBlast_PDB 84.0836%-116 - C1 -3PUW - MALK_ECOLI -
26 PsiBlast_CBE 84.0636%-116 - C1 -4KI0 - ? -
130 HHSearch 84.0432%-107 - C1 -3GFO - ECFA3_CLOP1 -
13 PsiBlast_PDB 83.7636%-114 - C1 -3PUZ - MALK_ECOLI -
108 Fugue 83.6032%-109 - C1 -1OXS - ? -
34 PsiBlast_CBE 83.5536%-109 - C1 -2AWO - MALK_ECOLI -
35 PsiBlast_CBE 83.4736%-120 - C1 -2AWN - MALK_ECOLI -
3 PsiBlast_PDB 83.2236%-115 - C1 -4TQU - ? -
22 PsiBlast_CBE 82.9636%-123 - C1 -2ONK - WTPC_ARCFU -
6 PsiBlast_PDB 73.6739%-123 - C1 -1VCI 3.9 ?
90 PsiBlast_CBE 71.3331%-103 * C1 *4MKI 2.1 ECFA2_CALS4
91 PsiBlast_CBE 70.7931%-101 - C1 -4MKI 2.0 ECFA2_CALS4
59 PsiBlast_CBE 69.7534%-106 - C1 -4YMU 4.2 ?
65 PsiBlast_CBE 68.9433% -96 - C1 -3C4J 3.2 ?
57 PsiBlast_CBE 68.8934%-101 - C1 -4YMV 3.9 ?
56 PsiBlast_CBE 68.7234%-107 - C1 -4YMV 4.2 ?
58 PsiBlast_CBE 68.7034%-106 - C1 -4YMU 4.7 ?
64 PsiBlast_CBE 68.6933% -90 - C1 -3C41 5.1 ?
78 PsiBlast_CBE 68.2733% -93 - C1 -2OLJ 3.7 ?
73 PsiBlast_CBE 68.2133% -91 - C1 -2OLK 4.0 ?
75 PsiBlast_CBE 66.9833% -91 - C1 -2OLK 3.9 ?
77 PsiBlast_CBE 66.7933% -82 - C1 -2OLJ 3.7 ?
68 PsiBlast_CBE 66.7833% -89 - C1 -2Q0H 3.3 ?
67 PsiBlast_CBE 66.1133% -88 - C1 -2Q0H 3.8 ?
74 PsiBlast_CBE 66.0833% -84 - C1 -2OLK 4.5 ?
55 PsiBlast_CBE 66.0237% -83 - C1 -3FVQ 4.6 FBPC_NEIG1
54 PsiBlast_CBE 65.8637% -78 - C1 -3FVQ 5.5 FBPC_NEIG1
66 PsiBlast_CBE 65.6033% -86 - C1 -3C4J 4.7 ?
76 PsiBlast_CBE 65.0733% -85 - C1 -2OLK 3.9 ?
63 PsiBlast_CBE 65.0233% -93 - C1 -3C41 4.0 ?
89 PsiBlast_CBE 61.6131% -98 - C1 -4U00 4.4 ?
83 PsiBlast_CBE 60.1531% -92 - C1 -4P33 2.9 LPTB_ECOLI
84 PsiBlast_CBE 58.8431% -95 - C1 -4P33 2.7 LPTB_ECOLI
100 PsiBlast_CBE 47.0232% -83 - C1 -4AYW 3.5 ABCBA_HUMAN
97 PsiBlast_CBE 45.9632% -79 - C1 -4AYX 3.2 ABCBA_HUMAN
98 PsiBlast_CBE 45.8732% -74 - C1 -4AYT 3.6 ABCBA_HUMAN
102 PsiBlast_CBE 40.0431% -86 - C1 -1MV5 3.9 LMRA_LACLA
101 PsiBlast_CBE 36.5931% -74 - C1 -1MV5 2.8
104 PsiBlast_CBE 35.1231% -77 - C1 -1MV5 4.4 LMRA_LACLA
103 PsiBlast_CBE 34.9731% -55 - C1 -1MV5 4.1 LMRA_LACLA